DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Olr833

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001000408.1 Gene:Olr833 / 298397 RGDID:1332684 Length:316 Species:Rattus norvegicus


Alignment Length:323 Identity:69/323 - (21%)
Similarity:131/323 - (40%) Gaps:70/323 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 FLIMAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLMLIKC------PIAIY 174
            |::...:||    :..:||||::.:......|.:|....:.||::.|.     |      |:.:.
  Rat    28 FVLCLGIYC----ITLLGNAFLVGLIVMDPHLHSPMYFFISNLSLIDI-----CGTSSFTPMMLL 83

  Fly   175 NNIKEGPALGDIACRLYGFVGGLSGTCAIGT-----LTAIALDRYNVVVHPLQPL-----RRCSR 229
            |.:.....:...:|.|..::     |.|:||     |..:|.|||..:..||:.|     :.|::
  Rat    84 NFLDVQRTISFPSCALQMYL-----TLALGTTECLLLVVMAYDRYVAICQPLRYLELMNGQLCTQ 143

  Fly   230 LRSYLIILLIWCYSFLFAVMPALDIGLSVYVPEGFLTTCSFDYLNK---EMPARIFMA------- 284
            :.:     .||...|..:::.::   |:..:|     .|....:|.   |:.|.:.:|       
  Rat   144 MAA-----TIWGTGFANSLLHSI---LAWRLP-----FCGHHIINHFFCEILAVLKLACGDISLN 195

  Fly   285 --LFFVAAYCI---PLTSIVYSYFYILKVVFTASRIQSNKDKAKTEQKLAFIVAAIIGLWFLAWS 344
              |..||...:   ||..|..||.:||..:.   ||.|...::|.....:..:..::..      
  Rat   196 ALLLMVATVVLTVTPLLLICLSYIFILTAIL---RIPSATGRSKAFSTCSAHLTVVVIF------ 251

  Fly   345 PYAIVAMMGVFGLERHITPLGSMIPALFCKTAACVDPYLYAATHPRFRVEVRMLFYGRGVLRR 407
             |..::.| .|..:.....:|.:|..|:...|..::.::|:..:...|..|..|.:| |:|.|
  Rat   252 -YGTISFM-YFKPKDQDPSVGKIITLLYAIVAPSLNAFIYSLRNTEVRAAVTALVWG-GLLTR 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 30/137 (22%)
7tm_1 133..384 CDD:278431 58/281 (21%)
Olr833NP_001000408.1 7tm_4 34..303 CDD:304433 63/306 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.