DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Npbwr1

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001014784.1 Gene:Npbwr1 / 297795 RGDID:1305917 Length:329 Species:Rattus norvegicus


Alignment Length:325 Identity:86/325 - (26%)
Similarity:141/325 - (43%) Gaps:57/325 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 NPFWLQFEPPKSSTFLIMAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLML 166
            ||..|....|.:   :.:..:|.:|..||..||:.|:::......::|..|:.::||||.|.|..
  Rat    28 NPAPLPLPQPLA---VAVPVVYGVICAVGLAGNSAVLYVLLRTPRMKTVTNVFILNLAIADELFT 89

  Fly   167 IKCPIAIYNNIKEGPALGDIACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQPLRRCSRLR 231
            :..||.|.:.:......|::.|:|...|...:...::..|..::.|||.||:...:. ||.|. |
  Rat    90 LVLPINIADFLLRRWPFGEVMCKLIVAVDQYNTFSSLYFLAVMSADRYLVVLATAES-RRVSG-R 152

  Fly   232 SY----LIILLIWCYSFL----FAVMPALD-------IGLSVYVPEGFLTTCSFDYLNKEMPARI 281
            :|    .:.|.:|....|    |||...||       ..|....||.|....|          |:
  Rat   153 TYGAARAVSLAVWALVTLVVLPFAVFARLDEEQGRRQCVLVFPQPEAFWWRAS----------RL 207

  Fly   282 FMALFFVAAYCIPLTSIVYSYFYILKVVFTASRIQSNK---DKAKTEQKLAFIVAAIIGLWFLAW 343
            :.   .|..:.||:::|...|..:| ....|.::.|:.   |:||  :::..:|.||:.:..|.|
  Rat   208 YT---LVLGFAIPVSTICALYITLL-CRLRAIQLDSHAKALDRAK--KRVTLLVVAILAVCLLCW 266

  Fly   344 SPY---AIVAMMG-------VFGLERHITPLGSMIPALFCKTAACVDPYLYAATHPRFRVEVRML 398
            :||   .|||:..       |.|:...||.|.        ...:|::|:|||.....||..:|.|
  Rat   267 TPYHLSTIVALTTDLPQTPLVIGISYFITSLS--------YANSCLNPFLYAFLDDSFRRSLRQL 323

  Fly   399  398
              Rat   324  323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 35/129 (27%)
7tm_1 133..384 CDD:278431 71/278 (26%)
Npbwr1NP_001014784.1 7tm_1 56..309 CDD:278431 71/278 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334343
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.