DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Oprk1

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_038965287.1 Gene:Oprk1 / 29335 RGDID:69426 Length:431 Species:Rattus norvegicus


Alignment Length:332 Identity:84/332 - (25%)
Similarity:155/332 - (46%) Gaps:46/332 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 QFEPPKSSTFL--IMAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLMLIKC 169
            |.||...|..:  |:.|:|.::.|||.|||:.|:|:......::|..||.:.|||:.|.|:....
  Rat    99 QLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTM 163

  Fly   170 PI--AIYNNIKEGPALGDIACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQPLRRCSRLRS 232
            |.  |:|  :......||:.|::...:...:...:|.|||.:::|||..|.||::.|...:.|::
  Rat   164 PFQSAVY--LMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKA 226

  Fly   233 YLIILLIWCYSFLFAVMPALDIGLSVYVPEGF-------LTTCSFDYLNKEMP-ARIFMAL-FFV 288
            .:|.:.||        :.|..:|:|..|..|.       :..||..:.:.|.. ..:||.: .||
  Rat   227 KIINICIW--------LLASSVGISAIVLGGTKVREDVDVIECSLQFPDDEYSWWDLFMKICVFV 283

  Fly   289 AAYCIPLTSIVYSYFYILKVVFTASRIQSNKDKAKTEQKLAFIVAAIIGLWFLAWSPYAIVAMMG 353
            .|:.||:..|:..|..::..:.:...:..:::|.:..:::..:|..::.::.:.|:|..|..::.
  Rat   284 FAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITKLVLVVVAVFIICWTPIHIFILVE 348

  Fly   354 VFGLERHITPLGSMIPALFC----KTAACVDPYLYAATHPRFR---------VEVRMLFYGRGVL 405
            ..|...|.|.:.|..  .||    .|.:.::|.|||.....|:         :::||        
  Rat   349 ALGSTSHSTAVLSSY--YFCIALGYTNSSLNPVLYAFLDENFKRCFRDFCFPIKMRM-------- 403

  Fly   406 RRVSTTR 412
            .|.||.|
  Rat   404 ERQSTNR 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 37/123 (30%)
7tm_1 133..384 CDD:278431 63/265 (24%)
Oprk1XP_038965287.1 7tmA_Kappa_opioid_R 111..392 CDD:320219 74/292 (25%)
TM helix 1 113..137 CDD:320219 10/23 (43%)
TM helix 2 146..167 CDD:320219 8/20 (40%)
TM helix 3 183..205 CDD:320219 4/21 (19%)
TM helix 4 228..244 CDD:320219 5/23 (22%)
TM helix 5 275..298 CDD:320219 8/22 (36%)
TM helix 6 324..346 CDD:320219 4/21 (19%)
TM helix 7 360..385 CDD:320219 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334348
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.