DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Oprl1

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001305876.1 Gene:Oprl1 / 29256 RGDID:68438 Length:396 Species:Rattus norvegicus


Alignment Length:426 Identity:87/426 - (20%)
Similarity:167/426 - (39%) Gaps:89/426 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 HYRDKYDLSYIAKVNPFWLQFEPPKSSTFL------IMAALYCLISVVGCVGNAFVIFMFANRKS 146
            |::.  :||.:.:..|..|... ...|.||      .:..||..:.:.|.:||..|:::......
  Rat    17 HFQG--NLSLLNETVPHHLLLN-ASHSAFLPLGLKVTIVGLYLAVCIGGLLGNCLVMYVILRHTK 78

  Fly   147 LRTPANILVMNLAICDFLMLIKCPIAIYNNIKEGPALGDIACRLYGFVGGLSGT-CAIG------ 204
            ::|..||.:.|||:.|.|:|:..|.       :|.   ||....:.|...|..| .||.      
  Rat    79 MKTATNIYIFNLALADTLVLLTLPF-------QGT---DILLGFWPFGNALCKTVIAIDYYNMFT 133

  Fly   205 ---TLTAIALDRYNVVVHPLQPLRRCSRLRSYLIILLIWCYSFLFAVMPAL---------DIGLS 257
               ||||:::|||..:.||::.|...:..::..:.:.||..:.:..|..|:         :|...
  Rat   134 STFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECL 198

  Fly   258 VYVPEGFLTTCSFDYLNKEMPARIFMALFFVAAYCIPLTSIVYSYFYILKVVFTASRIQSNKDKA 322
            |.:|      ...||...     :|....|:.::.||:..|...|..:::.:.....:..:::|.
  Rat   199 VEIP------APQDYWGP-----VFAICIFLFSFIIPVLIISVCYSLMIRRLRGVRLLSGSREKD 252

  Fly   323 KTEQKLAFIVAAIIGLWFLAWSPYAIVAMMGVFGLE----------RHITPLGSMIPALFCKTAA 377
            :..:::..:|..::.::...|:|..:..::...|::          |..|.||.:        .:
  Rat   253 RNLRRITRLVLVVVAVFVGCWTPVQVFVLVQGLGVQPGSETAVAILRFCTALGYV--------NS 309

  Fly   378 CVDPYLYAATHPRFRVEVRMLFYGRGVLRRVSTTRSSYMTRSRSSFTHRLRTSTTGEGGMGDHRM 442
            |::|.|||.....|:...|.......:.|.:..             :.|:| |...:.|:|....
  Rat   310 CLNPILYAFLDENFKACFRKFCCASSLHREMQV-------------SDRVR-SIAKDVGLGCKTS 360

  Fly   443 ENY----LMNNNLMMVPEETEE----NEEIVVVAEI 470
            |..    .:..:|.|||...:.    |.|:..|..:
  Rat   361 ETVPRPAXLGVDLPMVPVSPQSPSTPNTELTQVTAL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 34/131 (26%)
7tm_1 133..384 CDD:278431 57/279 (20%)
Oprl1NP_001305876.1 7tm_4 63..>185 CDD:304433 35/131 (27%)
7tm_1 65..316 CDD:278431 57/279 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334347
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.