DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Olr1029

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001001366.1 Gene:Olr1029 / 288850 RGDID:1333243 Length:312 Species:Rattus norvegicus


Alignment Length:312 Identity:64/312 - (20%)
Similarity:111/312 - (35%) Gaps:70/312 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 NPFWLQFEPPKSSTFLIMAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLML 166
            :|.|      |:..|:.:...| |:|:   .||..:|.:......|:||....:.|.:..:....
  Rat    18 DPQW------KAVLFIFLLLTY-LLSI---TGNLTIITLTLVDTHLKTPMYFFLRNFSFLEISYT 72

  Fly   167 IKC-P--IAIYNNIKEGPALGDIA-----CRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQP 223
            ..| |  :.|.       |.||..     |....|...|.|......|.|::.|||..:..||..
  Rat    73 TTCIPKLLVIM-------ATGDKTISYGNCFTQVFFAFLFGASEFYLLAAMSYDRYVAICKPLHY 130

  Fly   224 LRRCSRLRSYLIILLIWCYSFLFAVMPALDIGLSVYVPEGFLTTCSFDYLNKE---------MPA 279
            :...:......:||..|...| |.:.|.|.:||::    .|..:...|:...:         ...
  Rat   131 MTIMNNKVCVQLILSCWLAGF-FVIFPPLVLGLNL----DFCASNIVDHFYCDTTPLLQLSCTDT 190

  Fly   280 RIFMALFFVAA---YCIPLTSIVYSYFYILKVVFTASRIQSNKDKAKTEQKLAFIVAAIIGLWFL 341
            :....:.||:|   ..:.|..::.||.||   ..|..:|.|...:.|.               |.
  Rat   191 QFLETMGFVSALVTLLLTLVMVIISYTYI---AMTILKIPSTSQRKKA---------------FS 237

  Fly   342 AWSPYAIVAMMG----VF-----GLERHITPLGSMIPALFCKTAACVDPYLY 384
            ..|.:.||..:.    :|     .:::.:: :...|..|....|..::|::|
  Rat   238 TCSSHMIVITLSYGSCIFIYLKPSVKQRVS-ISKGISVLNTSVAPLLNPFIY 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 30/129 (23%)
7tm_1 133..384 CDD:278431 56/279 (20%)
Olr1029NP_001001366.1 7tm_4 31..300 CDD:304433 60/293 (20%)
7tm_1 39..288 CDD:278431 56/279 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.