DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Olr1278

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_775152.2 Gene:Olr1278 / 286913 RGDID:1332744 Length:311 Species:Rattus norvegicus


Alignment Length:338 Identity:67/338 - (19%)
Similarity:130/338 - (38%) Gaps:72/338 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VSTGLSNYSNYPSYIHYRDKYDLSYIAKVNPFWLQFEPPKSSTFLIMAALYCLISVVGCVGNAFV 137
            ::||  ||..:|.:|       |:.::|           ||...:.:..|:..|.:|..|||..:
  Rat     1 MATG--NYCVFPEFI-------LTGLSK-----------KSELQMPLFVLFLGIYIVTVVGNLGM 45

  Fly   138 IFMFANRKSLRTPANILVMNLAICDFL-MLIKCPIAIYNNIKEGPALGDIAC--RLYGFVGGLSG 199
            |.:......|.||....:.:|:..|.. ..:..|..:.|.:.|...:....|  :|:.|:.....
  Rat    46 ITLIRLSSLLHTPMYYFLSSLSFIDLCHSTVITPKMLVNFVAEKNIISYTGCMTQLFFFLIFAIA 110

  Fly   200 TCAIGTLTAIALDRYNVVVHPLQPLRRCSRLRSYLIILLIWCYSFLFAVMPALDIGLSVYVPEGF 264
            .|.:  |.|:|.|||..:.:||    ..:.:.||.|.:.:....::..|:.|     |.:.  ||
  Rat   111 ECHM--LAAMAYDRYVAICNPL----LYNAIMSYQIYISMISGVYIIGVVCA-----SAHT--GF 162

  Fly   265 LTT---CSFDYLNKE----MP----------ARIFMALFF-VAAYCIPLTSIVYSYFYILKVVFT 311
            :..   |:.|.:|..    :|          ....:.||| .....:|..:|:.||.:|:..:. 
  Rat   163 MIRIQFCNLDVINHYFCDLLPLLELAHSSTYVNELLILFFGTFNIVVPTLTILTSYIFIIATIL- 226

  Fly   312 ASRIQSNKDKAKTEQKLAFIVAAIIGLW----FLAWSPYAIVAMMGVFGLERHITPLGSMIPALF 372
              .|:|.:.:.|.....:..:.|:...:    |:...|.::.:|           ..|.:....:
  Rat   227 --HIRSTEGRYKAFSTCSSHILAVAVFFGSAAFMYLQPSSVSSM-----------DQGKVSSVFY 278

  Fly   373 CKTAACVDPYLYA 385
            ......::|.:|:
  Rat   279 TIVVPMLNPLIYS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 29/124 (23%)
7tm_1 133..384 CDD:278431 52/275 (19%)
Olr1278NP_775152.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.