DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and NPBWR1

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_005276.2 Gene:NPBWR1 / 2831 HGNCID:4522 Length:328 Species:Homo sapiens


Alignment Length:301 Identity:78/301 - (25%)
Similarity:131/301 - (43%) Gaps:46/301 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLMLIKCPIAIYNNIKEGPALGDI 186
            :|.:|..||..||:.|:::......::|..|:.::||||.|.|..:..||.|.:.:......|::
Human    43 VYAVICAVGLAGNSAVLYVLLRAPRMKTVTNLFILNLAIADELFTLVLPINIADFLLRQWPFGEL 107

  Fly   187 ACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQPLRRCSRLRS--YLIILLIWCYSFL---- 245
            .|:|...:...:...::..||.::.|||.||:...:..|...|..|  ..:.|.:|....|    
Human   108 MCKLIVAIDQYNTFSSLYFLTVMSADRYLVVLATAESRRVAGRTYSAARAVSLAVWGIVTLVVLP 172

  Fly   246 FAVMPALD-------IGLSVYVPEGFLTTCSFDYLNKEMPARIFMALFFVAAYCIPLTSIVYSYF 303
            |||...||       ..|....||.|....|          |::.   .|..:.||:::|...|.
Human   173 FAVFARLDDEQGRRQCVLVFPQPEAFWWRAS----------RLYT---LVLGFAIPVSTICVLYT 224

  Fly   304 YILKVVFTASRIQSN-KDKAKTEQKLAFIVAAIIGLWFLAWSPY---AIVAMMG-------VFGL 357
            .:| ....|.|:.|: |...:.::::.|:|.||:.:..|.|:||   .:||:..       |..:
Human   225 TLL-CRLHAMRLDSHAKALERAKKRVTFLVVAILAVCLLCWTPYHLSTVVALTTDLPQTPLVIAI 288

  Fly   358 ERHITPLGSMIPALFCKTAACVDPYLYAATHPRFRVEVRML 398
            ...||.|.        ...:|::|:|||.....||..:|.|
Human   289 SYFITSLS--------YANSCLNPFLYAFLDASFRRNLRQL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 33/127 (26%)
7tm_1 133..384 CDD:278431 67/274 (24%)
NPBWR1NP_005276.2 7tmA_NPBWR 47..318 CDD:320215 75/292 (26%)
TM helix 2 72..98 CDD:320215 10/25 (40%)
TM helix 3 109..139 CDD:320215 8/29 (28%)
TM helix 4 153..175 CDD:320215 5/21 (24%)
TM helix 5 200..229 CDD:320215 8/42 (19%)
TM helix 6 244..274 CDD:320215 8/29 (28%)
TM helix 7 286..311 CDD:320215 8/32 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140655
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.