DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and CMKLR2

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001091669.1 Gene:CMKLR2 / 2825 HGNCID:4463 Length:355 Species:Homo sapiens


Alignment Length:346 Identity:79/346 - (22%)
Similarity:139/346 - (40%) Gaps:48/346 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 VNDSVSTGLSNYSNYPSYIHYRDKYDLSYIAKVNPFWLQFEPPKSSTFLIMAALYCLISVVGCVG 133
            :.|...|....:.||        .|||.|.:..:.  |:.:........:...||||..|:|..|
Human     1 MEDLEETLFEEFENY--------SYDLDYYSLESD--LEEKVQLGVVHWVSLVLYCLAFVLGIPG 55

  Fly   134 NAFVIFMFANRKSLRTPANILVMNLAICDFLMLIKCPIAI-YNNIKEGPALGDIACRLYGFVGGL 197
            ||.||: |...|..:|...:..:||||.||:.|:..|:.| |..:......|...|:...|...|
Human    56 NAIVIW-FTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQL 119

  Fly   198 SGTCAIGTLTAIALDRYNVVVHPLQPLRRCSRLRSYLIILLIWCYSFLFAVMPALDIGLSVYVPE 262
            :...::..||.|:||.|..::||:...|..:...|.::|:.||..:.|..       |.::|   
Human   120 NMFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIG-------GPALY--- 174

  Fly   263 GFLTTCSFD-----YLN--KEMP------ARIFMALFFVAAYCIPLTSIVYSYFYILKVVFTASR 314
             |..|..|:     |.|  |..|      ..:...:.|:..|..||.::...|..::..|...|.
Human   175 -FRDTVEFNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSI 238

  Fly   315 IQSNKDKAKTEQKLAFIVAAIIGLWFLAWSPYAIVAMMGVF----GLERHITPLGSMIPALFCKT 375
            :.|::.        .:.:..::..:.:.|:||.:.::..:.    ....|:...|..:.......
Human   239 LISSRH--------FWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFL 295

  Fly   376 AACVDPYLYAATHPRFRVEVR 396
            .:|::|.||.....:|:...|
Human   296 NSCLNPILYVLISKKFQARFR 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 39/122 (32%)
7tm_1 133..384 CDD:278431 60/268 (22%)
CMKLR2NP_001091669.1 7tmA_GPR1 39..315 CDD:320247 69/295 (23%)
TM helix 1 41..65 CDD:320247 12/24 (50%)
TM helix 2 73..94 CDD:320247 8/20 (40%)
TM helix 3 111..133 CDD:320247 5/21 (24%)
TM helix 4 156..172 CDD:320247 5/22 (23%)
TM helix 5 204..227 CDD:320247 4/22 (18%)
TM helix 6 245..267 CDD:320247 3/21 (14%)
TM helix 7 283..308 CDD:320247 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140658
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.