DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and OR7C2

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_036509.1 Gene:OR7C2 / 26658 HGNCID:8374 Length:319 Species:Homo sapiens


Alignment Length:331 Identity:69/331 - (20%)
Similarity:128/331 - (38%) Gaps:84/331 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 LIMAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLML-IKCPIAIYNNIKEG 180
            |::..|:..:.:|..:||..:|...::...|.||....:.||:..|.... ...|..:.|...:.
Human    25 LLLHGLFLSMYLVTIIGNLLIILTISSDSHLHTPMYFFLSNLSFADICFTSTTVPKMLVNIQTQS 89

  Fly   181 PALGDIAC--RLYGFVGGLSGTCAIG-----TLTAIALDRYNVVVHPL------QPLRRCSRLRS 232
            ..:....|  :::.|:       |.|     .||..|.||:..:.:||      .| |.|.    
Human    90 KMITFAGCLTQIFFFI-------AFGCLDNLLLTMTAYDRFVAICYPLHYTVIMNP-RLCG---- 142

  Fly   233 YLIILLIWCYSFLFAVMPALDI-----GLSVYVPEGFL-------TTCSFDYLNKEMPARIFMAL 285
             |::|..||.|.:.:::..|.|     ..::.:|..|.       ..||..::|.       :.:
Human   143 -LLVLGSWCISVMGSLLETLTILRLSFCTNMEIPHFFCDPSEVLKLACSDTFINN-------IVM 199

  Fly   286 FFVAAY--CIPLTSIVYSYFYILKVVFTASRIQSNKDKAKTEQKLAFIVAAIIGLWFLAWSPYAI 348
            :||...  ..||..|::||..|...|...|        |:.:.| ||....         |..::
Human   200 YFVTIVLGVFPLCGILFSYSQIFSSVLRVS--------ARGQHK-AFSTCG---------SHLSV 246

  Fly   349 VAM-----MGVFGLERHITP-----LGSMIPALFCKTAACVDPYLYAATHPRFRVEVRMLFYGRG 403
            |::     :||: |...:||     |.:.:  ::......::|::|:..:...:..:     ||.
Human   247 VSLFYGTGLGVY-LSSAVTPPSRTSLAASV--MYTMVTPMLNPFIYSLRNKDMKGSL-----GRL 303

  Fly   404 VLRRVS 409
            :||..|
Human   304 LLRATS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 31/135 (23%)
7tm_1 133..384 CDD:278431 60/288 (21%)
OR7C2NP_036509.1 7tm_4 31..305 CDD:304433 64/319 (20%)
7tm_1 41..289 CDD:278431 60/288 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.