DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Olfr1353

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_667253.1 Gene:Olfr1353 / 259044 MGIID:3031187 Length:309 Species:Mus musculus


Alignment Length:314 Identity:68/314 - (21%)
Similarity:123/314 - (39%) Gaps:66/314 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 IMAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLML-IKCPIAIYNNIKEGP 181
            |:..|:..:.:|..|||..:|....:...|.||....:.||:..|...: ...|..:.|...:..
Mouse    26 IIYGLFLSMYLVTVVGNMLIIVAIISGPRLHTPMYFFLSNLSFVDICFISTTIPKMLVNIQTQNK 90

  Fly   182 ALGDIAC--RLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQPLRRCSRLRSY----LIILLIW 240
            .:....|  ::|.|:  |........||.:|.|||..:.||:    |.:.:.:|    .::|:.|
Mouse    91 VITYAGCITQIYFFL--LFVELDNFLLTIMAYDRYVAICHPM----RYTVIMNYQLCGFLVLVSW 149

  Fly   241 CYSFLFAVMPALDIGLSVYVPEGFLT-----------------TCSFDYLNKEMPARIFMALFF- 287
            ..|.|.|:..:|   :.:.:|  |.|                 |||..:||.       |.::| 
Mouse   150 IVSVLHALFQSL---MMLELP--FCTQPEIPHFFCEPNQVIQLTCSDAFLND-------MVIYFT 202

  Fly   288 -VAAYCIPLTSIVYSYFYILKVVFTASRIQSNKDKAKTEQKLAFIVAA----IIGLWFLAWSPYA 347
             |....:||..:.||||   |:|.:...:.|...|.|     ||...|    ::.|::...    
Mouse   203 LVLLAIVPLAGVFYSYF---KIVSSIRAMSSVHGKYK-----AFSTCASHLLVVSLFYCTG---- 255

  Fly   348 IVAMMGVF--GLERHITPLGSMIPALFCKTAACVDPYLYAATHPRFRVEVRMLF 399
                :||:  ....|.:...:.....:......::|::|:..:...:..::.||
Mouse   256 ----LGVYLSSAANHGSQTSATASVTYTVVTPMMNPFIYSLRNKDVKSALKRLF 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 31/128 (24%)
7tm_1 133..384 CDD:278431 61/282 (22%)
Olfr1353NP_667253.1 7tm_4 31..308 CDD:304433 66/309 (21%)
7tm_1 41..290 CDD:278431 61/282 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.