DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Olfr1413

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_667248.1 Gene:Olfr1413 / 259039 MGIID:3031247 Length:323 Species:Mus musculus


Alignment Length:296 Identity:59/296 - (19%)
Similarity:116/296 - (39%) Gaps:48/296 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 SSTFLIMAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDF-LMLIKCPIAIYNN 176
            :.|..::.|::..:.||..:||..:|.:......|.:|....:.||:..|| ...:..|.|:...
Mouse    28 AKTQALLFAVFLTLYVVTVLGNLTMIVVITLDARLHSPMYFFLKNLSFVDFCYSSVIAPKAMTIF 92

  Fly   177 IKEGPALGDIACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQ------PLRRCSRLRSYLI 235
            :.....:....|....|...|..|.....|..:|.||:..:..||:      |: .|:||     
Mouse    93 LSSSKVISFAGCATQFFFFSLLVTTEGFLLAVMAYDRFMAICSPLRYPVTMCPM-ACARL----- 151

  Fly   236 ILLIWCYSFLFAVMPALDIGLSVYVPEGFLTTCSFDYLNKEMPARIFMA----------LFFVAA 290
            :|..:|...|.::   :...|:..:|  |.::...|:...::|..:.:|          :|.:..
Mouse   152 VLGTYCGGCLNSI---VQTSLTFQLP--FCSSNRIDHFYCDVPPLLQLACADTTLNEFVMFGICG 211

  Fly   291 YCIPLTSIV--YSYFYILKVVFTASRIQSNKDKAKTEQKLAFIVAAI---IGLWFLAWS-PYAIV 349
            ..|..|::|  .||.||   ..|..|::|...:.|........:.|:   .|..|:.:: |.|:.
Mouse   212 LIIVSTTLVVLISYGYI---TMTILRMRSGSGRHKVFSTCGSHMTAVSLFYGTVFVMYAQPGALT 273

  Fly   350 AMMGVFGLERHITPLGSMIPALFCKTAACVDPYLYA 385
            :|           ..|.::...:......::|.:|:
Mouse   274 SM-----------EQGKVVSVFYTLVIPMLNPLIYS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 30/128 (23%)
7tm_1 133..384 CDD:278431 54/273 (20%)
Olfr1413NP_667248.1 7tm_4 38..311 CDD:304433 57/286 (20%)
7tm_1 48..297 CDD:278431 54/273 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.