DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Olfr1163

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_666855.1 Gene:Olfr1163 / 258638 MGIID:3030997 Length:316 Species:Mus musculus


Alignment Length:312 Identity:66/312 - (21%)
Similarity:112/312 - (35%) Gaps:94/312 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 FLIMAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDF-LMLIKCPIAIYNNIKE 179
            |||...:| :|:|||.:|...:|.:   .....||....:.:|:..|| ...|..|..:.|.:..
Mouse    30 FLIFLFMY-IITVVGNLGMTVLINI---DHKFHTPMYFFLSHLSFVDFCYSTIITPKLLENLVLA 90

  Fly   180 GPALGDIACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPL------QPLRRC------SRLRS 232
            ...:...:|.|..|:..::.......|..:|.||:..:.:||      .| |.|      |.:.|
Mouse    91 DKTILYFSCMLQYFLSCVALVSESYLLAVMAYDRFVAICNPLLYTVAMSP-RLCILLVTGSYIWS 154

  Fly   233 YLIILLIWCYSF------------LFAVMPALDIGLS--VYVPEGFLTTCSFDYLNKEMPARIFM 283
            ....|::.||:.            .|....||.:..|  :::| ..|..| |...|:        
Mouse   155 TFETLILLCYALQLKFSRFNVINHFFCEYTALIVVSSSDIHIP-SLLLFC-FATFNE-------- 209

  Fly   284 ALFFVAAYCIPLTSIVYSYFYILKVVFTASRIQSNKDKAKTEQKLAFIVAAIIGLWFLAWSPYAI 348
                |:...|.|||.|..:..:||:            |:.:.::.||...|              
Mouse   210 ----VSTLLIILTSYVLIFVTVLKI------------KSASGRRKAFSTCA-------------- 244

  Fly   349 VAMMGVFGLERHITPL----GSMIPALFC-------KTAACVDPYLYAATHP 389
                      .|:|.:    |::: :|:|       :.|..|....||..:|
Mouse   245 ----------SHLTAITIFHGTIL-SLYCVPNSKNSRNAVKVASVFYAVVNP 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 31/146 (21%)
7tm_1 133..384 CDD:278431 55/288 (19%)
Olfr1163NP_666855.1 7tm_4 33..308 CDD:304433 63/309 (20%)
7tm_1 43..292 CDD:278431 59/298 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.