DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Sstr4

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_037168.1 Gene:Sstr4 / 25555 RGDID:3764 Length:384 Species:Rattus norvegicus


Alignment Length:318 Identity:76/318 - (23%)
Similarity:150/318 - (47%) Gaps:34/318 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 DLSYIAKVNPFW--------LQFEPPKSSTFLIMAALYCLISVVGCVGNAFVIFMFANRKSLRTP 150
            |.::...:|..|        ::.:...::..:.:..:|.|:.:||.||||.|||:......::|.
  Rat    13 DTTWTPGINASWAPDEEEDAVRSDGTGTAGMVTIQCIYALVCLVGLVGNALVIFVILRYAKMKTA 77

  Fly   151 ANILVMNLAICDFLMLIKCP-IAIYNNIKEGPALGDIACRLYGFVGGLSGTCAIGTLTAIALDRY 214
            .||.::|||:.|.|.::..| :|....::..| .|.:.||....|.||:...::..||.:::|||
  Rat    78 TNIYLLNLAVADELFMLSVPFVASAAALRHWP-FGAVLCRAVLSVDGLNMFTSVFCLTVLSVDRY 141

  Fly   215 NVVVHPLQ--PLRRCSRLRSYLIILLIWCYSFLFAVMPALDIGLSVYVPE-----GFLTTCSFDY 272
            ..|||||:  ..||.|..:  ||.|.:|..|.|      :.:.::|:...     |....|:..:
  Rat   142 VAVVHPLRAATYRRPSVAK--LINLGVWLASLL------VTLPIAVFADTRPARGGEAVACNLHW 198

  Fly   273 LNKEMPARIFMALFFVAAYCIPLTSIVYSYFYILKVVFTASRIQSNKDKAKTEQKLAFIVAAIIG 337
            .:....| :|:...|:..:.:|:.:|...|..|:..:...:.....:.:.::|:|:..:|..::.
  Rat   199 PHPAWSA-VFVIYTFLLGFLLPVLAIGLCYLLIVGKMRAVALRAGWQQRRRSEKKITRLVLMVVT 262

  Fly   338 LWFLAWSPYAIVAMMGVFGLERHITPLGSM---IPALFCKTAACVDPYLYAATHPRFR 392
            ::.|.|.|:.:|.::.:|     :|.|.:.   :..:.....:|.:|.||......||
  Rat   263 VFVLCWMPFYVVQLLNLF-----VTSLDATVNHVSLILSYANSCANPILYGFLSDNFR 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 46/124 (37%)
7tm_1 133..384 CDD:278431 64/261 (25%)
Sstr4NP_037168.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 3/20 (15%)
7tm_4 52..283 CDD:304433 64/245 (26%)
7tm_1 60..307 CDD:278431 64/261 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334351
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.