DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Gpr1

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001343974.1 Gene:Gpr1 / 241070 MGIID:2385324 Length:353 Species:Mus musculus


Alignment Length:390 Identity:88/390 - (22%)
Similarity:157/390 - (40%) Gaps:92/390 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LSNYSNYPSYIHYRDKYDLSYIAKVNPFWLQFEPPKSSTFL-----IMAALYCLISVVGCVGNAF 136
            |.|||           |.|.|       :.|...|:...:|     |...||.|..|:|..|||.
Mouse    12 LDNYS-----------YALDY-------YSQESDPEEKVYLGLVHWISLFLYALAFVLGIPGNAI 58

  Fly   137 VIFM--FANRKSLRTPANILVMNLAICDFLMLIKCPIAI-YNNIKEGPALGDIACRLYGFVGGLS 198
            ||::  |..:|::.|   :..:||||.||:.::..|:.| |..:......|...|::..|:..|:
Mouse    59 VIWLMGFKWKKTVTT---LWFLNLAIADFIFVLFLPLYISYVALSFHWPFGLWLCKVNSFIAQLN 120

  Fly   199 GTCAIGTLTAIALDRYNVVVHPLQPLRRCSRLRSYLIILLIWCYSFLFAVMPALDIGLSVYVPEG 263
            ...::..||.|:||||..::||....|..:...|.::::|:|..:.|..       |.::|    
Mouse   121 MFSSVFFLTVISLDRYIHLLHPGLSHRHRTLKSSLVVVILVWLLASLLG-------GPTLY---- 174

  Fly   264 FLTT--------CSFDYLNKE---MPARIFMALFFVAAYCIPLTSIVYSYFYILKVVFTASRIQS 317
            |..|        |..::...|   |...:...:.|:..|..||.::...|..::        .:.
Mouse   175 FRDTMEVNNHIICYNNFQEHELTLMRHHVLTWVKFLFGYLFPLLTMSSCYLCLI--------FKM 231

  Fly   318 NKDKAKTEQKLAFIVAAIIGLWFLAWSPYAIVAMMGVFGLERHIT-----------PLGSMIPAL 371
            .|......:|..:::.:::..:.:.|:||   .:..::.|..|..           ||.:.:..|
Mouse   232 KKRNILISRKHLWMILSVVIAFLVCWTPY---HLFSIWELSIHHNSSFQNVLQGGIPLSTGLAFL 293

  Fly   372 FCKTAACVDPYLYA----ATHPRFRVEVRMLFYGRGVLRRVSTTRSSYMTRSRSSFTHRLRTSTT 432
                .:|::|.||.    ....|||..|      ..||:     ||.:......:.:.:||::.|
Mouse   294 ----NSCLNPILYVLISKTFQARFRASV------AEVLK-----RSLWEASCSGTVSEQLRSAET 343

  Fly   433  432
            Mouse   344  343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 38/124 (31%)
7tm_1 133..384 CDD:278431 59/275 (21%)
Gpr1NP_001343974.1 7tmA_GPR1 39..313 CDD:320247 67/302 (22%)
TM helix 1 40..66 CDD:320247 11/25 (44%)
TM helix 2 72..97 CDD:320247 9/27 (33%)
TM helix 3 110..140 CDD:320247 10/29 (34%)
TM helix 4 152..172 CDD:320247 5/26 (19%)
TM helix 5 201..226 CDD:320247 5/24 (21%)
TM helix 6 237..267 CDD:320247 4/32 (13%)
TM helix 7 281..306 CDD:320247 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830628
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.