DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Gpr149

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_796320.2 Gene:Gpr149 / 229357 MGIID:2443628 Length:732 Species:Mus musculus


Alignment Length:234 Identity:55/234 - (23%)
Similarity:89/234 - (38%) Gaps:37/234 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TGLSNYSNYPSYIHYRDKYDLSYIAKVNPFWLQFEPPKSSTFLIMAALYCLISVVGCVGNAFVIF 139
            :.|:|.||.....|...:.||            ...|.:.| |.:..|.|::::...||:.|.:.
Mouse     6 SNLTNDSNLWKASHNSTETDL------------MNSPATLT-LSLFCLICIMTLAALVGSIFSLV 57

  Fly   140 MFANRKSLRTPANILVMNLAICDFLMLIKCPIAIYNNI---KEGPALGDIACRLYGFVGGLSGTC 201
            .....: .||..:|||.:.::.|.|.::.  :||:..:   ||........|.....:....|..
Mouse    58 SLLTMQ-YRTVLSILVTSWSVDDLLSVLS--VAIFMVLQWPKEAQGYFQSLCTTSALLYMCQGLS 119

  Fly   202 AIGTLTAIALDRYNVVVHPLQPLRRCSRLRSYL-IILLIWCYSFLFAVMPALDIGLSVYVPEGFL 265
            :....|.|....:..:...::......||...| :.|.:|..|.|.|.:|....|:.|..|.|.|
Mouse   120 SNLKATLIVCYNFYTMNRTVESQSSSWRLGQVLGVTLTVWAVSLLLASLPLCGWGVFVRTPWGCL 184

  Fly   266 TTCSFDYLNKEMPARIFMALFFV--------AAYCIPLT 296
            |.||..|:         :.||.|        |...:|||
Mouse   185 TDCSSPYV---------LLLFAVYASAFGLLAVLSVPLT 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 25/125 (20%)
7tm_1 133..384 CDD:278431 42/176 (24%)
Gpr149NP_796320.2 7tm_1 56..>211 CDD:278431 37/166 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..302
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 501..526
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830632
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.