DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Npbwr1

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_034472.1 Gene:Npbwr1 / 226304 MGIID:891989 Length:329 Species:Mus musculus


Alignment Length:305 Identity:84/305 - (27%)
Similarity:135/305 - (44%) Gaps:54/305 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLMLIKCPIAIYNNIKEGPALGDI 186
            :|.:|..||..||:.|:::......::|..|:.::||||.|.|..:..||.|.:.:......|::
Mouse    45 VYGVICAVGLAGNSAVLYVLLRTPRMKTVTNVFILNLAIADELFTLVLPINIADFLLRRWPFGEV 109

  Fly   187 ACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQPLRRCSRLRSY----LIILLIWCYSFL-- 245
            .|:|...|...:...::..|..::.|||.||:...:. ||.|. |:|    .:.|.:|....|  
Mouse   110 MCKLIVAVDQYNTFSSLYFLAVMSADRYLVVLATAES-RRVSG-RTYGAARAVSLAVWALVTLVV 172

  Fly   246 --FAVMPALD-------IGLSVYVPEGFLTTCSFDYLNKEMPARIFMALFFVAAYCIPLTSIVYS 301
              |||...||       ..|....||.|....|          |::.   .|..:.||:|:|...
Mouse   173 LPFAVFARLDEEQGRRQCVLVFPQPEAFWWRAS----------RLYT---LVLGFAIPVTTICAL 224

  Fly   302 YFYILKVVFTASRIQSNK---DKAKTEQKLAFIVAAIIGLWFLAWSPY---AIVAMMG------- 353
            |..:| ....|.::.|:.   |:||  :::..:||||:.:..|.|:||   .|||:..       
Mouse   225 YTTLL-CRLRAIQLDSHAKALDRAK--KRVTLLVAAILAVCLLCWTPYHLSTIVALTTDLPQTPL 286

  Fly   354 VFGLERHITPLGSMIPALFCKTAACVDPYLYAATHPRFRVEVRML 398
            |.|:...||.|.        ...:|::|:|||.....||..:|.|
Mouse   287 VIGISYFITSLS--------YANSCLNPFLYAFLDDSFRRSLRQL 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 35/129 (27%)
7tm_1 133..384 CDD:278431 73/278 (26%)
Npbwr1NP_034472.1 7tm_1 56..309 CDD:278431 73/278 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830625
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.