DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Sstr5

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001177937.1 Gene:Sstr5 / 20609 MGIID:894282 Length:362 Species:Mus musculus


Alignment Length:317 Identity:89/317 - (28%)
Similarity:149/317 - (47%) Gaps:31/317 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 WLQFEP--PKSSTFLIMAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLMLI 167
            |...:|  |..:..:::..||.|:..||..||..||::......::|..|:.::|||:.|.|.::
Mouse    24 WSLVDPVSPMGARAVLVPVLYLLVCTVGLGGNTLVIYVVLRYAKMKTVTNVYILNLAVADVLFML 88

  Fly   168 KCP-IAIYNNIKEGPALGDIACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQPLR----RC 227
            ..| :|..|.:...| .|...|||...:.|::...:|..|..:::|||..|||||:..|    |.
Mouse    89 GLPFLATQNAVSYWP-FGSFLCRLVMTLDGINQFTSIFCLMVMSVDRYLAVVHPLRSARWRRPRV 152

  Fly   228 SRLRSYLIILLIWCYSFLFAVMPALDIGLSVYVPEGFLTTCSFDYLNKEMPARIFMALFF----V 288
            ::|.|    ..:|.:|.|.: :|.|   :...|.||: .||:   |:...|..::.|.|.    |
Mouse   153 AKLAS----AAVWVFSLLMS-LPLL---VFADVQEGW-GTCN---LSWPEPVGLWGAAFITYTSV 205

  Fly   289 AAYCIPLTSIVYSYFYI-LKVVFTASRIQSNKDKAKTEQKLAFIVAAIIGLWFLAWSPYAIVAMM 352
            ..:..||..|...|..| :||.....|:.|:: :.::|:|:..:|..::.::...|.|:.||.::
Mouse   206 LGFFGPLLVICLCYLLIVVKVKAAGMRVGSSR-RRRSERKVTRMVVVVVLVFVGCWLPFFIVNIV 269

  Fly   353 GV-FGLERHITPLGSMIPALFCKTA-ACVDPYLYAATHPRFRVEVR---MLFYGRGV 404
            .: |.|....|..|.....:....| :|.:|.||......||...|   .|..|.||
Mouse   270 NLAFTLPEEPTSAGLYFFVVVLSYANSCANPLLYGFLSDNFRQSFRKALCLRRGYGV 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 40/126 (32%)
7tm_1 133..384 CDD:278431 72/262 (27%)
Sstr5NP_001177937.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 89/317 (28%)
7tm_4 48..>227 CDD:304433 57/191 (30%)
7tm_1 54..303 CDD:278431 72/262 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 330..362
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830626
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.