DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Opn4

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_620215.1 Gene:Opn4 / 192223 RGDID:621701 Length:474 Species:Rattus norvegicus


Alignment Length:338 Identity:110/338 - (32%)
Similarity:184/338 - (54%) Gaps:21/338 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 WLQF---EPPKSSTFLIMAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLM- 165
            |:.|   :.|..:.: .:..:..|:.:.|.:||..||:.|...:.||||||:|::|||:.|||| 
  Rat    57 WVPFPTVDVPDHAHY-TLGTVILLVGLTGMLGNLTVIYTFCRNRGLRTPANMLIINLAVSDFLMS 120

  Fly   166 LIKCPIAIYNNIKEGPALGDIACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQPLRRCSRL 230
            ..:.|:...:::.:....|:..|:.|.|.|.:.|..::.||||||:|||.|:..||..:...|:.
  Rat   121 FTQAPVFFASSLYKKWLFGETGCKFYAFCGAVFGIVSMITLTAIAMDRYLVITRPLATIGMRSKR 185

  Fly   231 RSYLIILLIWCYSFLFAVMPALDIGLSVYVPEGFLTTCSFDYLNKEMPARIFMALFFVAAYCIPL 295
            |:.|::|.:|.|:..:::.|.  .|.|.|||||.||:||:||:......|.:..|.|...:.:||
  Rat   186 RTALVLLGVWLYALAWSLPPF--FGWSAYVPEGLLTSCSWDYVTFTPLVRAYTMLLFCFVFFLPL 248

  Fly   296 TSIVYSYFYILKVVFTASRI----------QSNKDKAKTEQKLAFIVAAIIGLWFLAWSPYAIVA 350
            ..|::.|.:|.:.:....|.          :....:.::|.|:|.:...:|.|:.|:|:||:.||
  Rat   249 LIIIFCYIFIFRAIRETGRACEGCGESPLRRRQWQRLQSEWKMAKVALIVILLFVLSWAPYSTVA 313

  Fly   351 MMGVFGLERHITPLGSMIPALFCKTAACVDPYLYAATHPRFRVEVRMLFYGRGVLRRVSTTRS-- 413
            ::|..|....:||..|.:||:..|.:|..:|.:||.|||::|..:.......|||..||..||  
  Rat   314 LVGFAGYSHILTPYMSSVPAVIAKASAIHNPIIYAITHPKYRAAIAQHLPCLGVLLGVSGQRSHP 378

  Fly   414 --SYMTRSRSSFT 424
              ||.:..||:.:
  Rat   379 SLSYRSTHRSTLS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 46/122 (38%)
7tm_1 133..384 CDD:278431 88/261 (34%)
Opn4NP_620215.1 7tm_4 78..>245 CDD:304433 63/168 (38%)
7tm_1 87..347 CDD:278431 88/261 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..474
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D389088at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.