DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and F09C12.6

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_494950.3 Gene:F09C12.6 / 184238 WormBaseID:WBGene00017278 Length:338 Species:Caenorhabditis elegans


Alignment Length:183 Identity:43/183 - (23%)
Similarity:66/183 - (36%) Gaps:52/183 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 FLFAVMPALDIGLSVYVPEGFLTTCSFDYLNKEMPARIFMALFFVAAYCIPLTSIVYSYFYILKV 308
            ||.|:..||:|.|       |....|...|.|:...||.|.|...            ..|..|.:
 Worm    31 FLGAICFALNIVL-------FAVFLSSPTLRKKHRNRILMILGLA------------DTFNTLAI 76

  Fly   309 VFTA-SRIQSNKDKAKTEQKLAFIVAAIIGLWFLAWSPYAIVAMMG---------VFGLERHITP 363
            :|.. :|::...:..:||:      ..|...|..|..|:.|:..:|         |.|::|   .
 Worm    77 LFMGKNRVELYTEVIQTEE------LPIRTAWQCALEPWLILRGIGDIWPPVVQMVIGIQR---A 132

  Fly   364 LGSMIPALFCKTAACVDPYLYAAT----HPRFRV---------EVRMLFY-GR 402
            |....|..|.|.......:|:|:|    .|...:         .|::|:| ||
 Worm   133 LAVFAPIWFHKNGRNRSSFLFASTLVILLPTLLIGFVIAYRKRNVKVLYYCGR 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 2/2 (100%)
7tm_1 133..384 CDD:278431 34/149 (23%)
F09C12.6NP_494950.3 7tm_GPCRs <125..302 CDD:391938 16/64 (25%)
TM helix 4 149..179 CDD:341315 5/29 (17%)
TM helix 5 204..228 CDD:341315
TM helix 6 231..257 CDD:341315
TM helix 7 266..288 CDD:341315
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.