DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Olfr32

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_035110.1 Gene:Olfr32 / 18331 MGIID:109303 Length:308 Species:Mus musculus


Alignment Length:342 Identity:69/342 - (20%)
Similarity:120/342 - (35%) Gaps:98/342 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 FEPP--KSSTFLIMAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFL----ML 166
            |:.|  :...|::...:| |.:|   :||..::......|||.:|....:..|::.:.|    ::
Mouse    15 FQDPDVQKVCFVLFLPVY-LATV---LGNGLIVVTVNISKSLYSPMYFFLNYLSLVEILYSSTVV 75

  Fly   167 IKCPIAIYNNIKEGPALGDIACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQPLRRCSRLR 231
            .|....:.|.||   .:....|....|.....|...|..||.:|.|||..:..||......||.:
Mouse    76 PKFITDLLNKIK---TISPKGCLAQIFFFHFFGVTEILLLTVMAYDRYVAICKPLYYTTIMSRPK 137

  Fly   232 SYLIILLIWCYSF------LFAVMP-------ALD-------------------IGLSVYVPEGF 264
            .:.::...|...|      :|..:|       .:|                   :|:.::|..|.
Mouse   138 CHRLVAGSWVGGFFHSIIQIFITLPLPFCGPNVIDHYFCDLHPLFKLACTDTFVVGVIMFVNSGL 202

  Fly   265 LTTCSFDYLNKEMPARIFMALFFVAAYCIPLTSIVYSYFYILKVVFTASRIQSNKDKAKTEQKLA 329
            .:..||              ||.|::|.:    |:|:.           |..|.:.:.|.....|
Mouse   203 FSVFSF--------------LFLVSSYIV----ILYNL-----------RNHSAEGRRKALSTCA 238

  Fly   330 ---FIVAAIIG----LWFLAWSPYAIVAMMGVFGLERHITPLGSMIPALFCKTAACVDPYLYAAT 387
               .:|....|    |:....|.|....::.||  ...|||:              ::|.:|...
Mouse   239 SHIMVVVLFFGPAIFLYLRPASTYTEDKLVAVF--YTVITPM--------------LNPIIYTLR 287

  Fly   388 HPRFRVEVRMLFYGRGV 404
            :...:..||.| :|:.|
Mouse   288 NAEVKNAVRKL-WGKKV 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 30/131 (23%)
7tm_1 133..384 CDD:278431 57/293 (19%)
Olfr32NP_035110.1 7tmA_OR4A-like 22..288 CDD:320605 62/317 (20%)
TM helix 1 23..49 CDD:320605 6/29 (21%)
TM helix 2 56..82 CDD:320605 3/25 (12%)
TM helix 3 94..124 CDD:320605 10/29 (34%)
TM helix 4 137..158 CDD:320605 2/20 (10%)
TM helix 5 192..222 CDD:320605 11/47 (23%)
TM helix 6 228..258 CDD:320605 5/29 (17%)
TM helix 7 263..288 CDD:320605 7/40 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.