DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Ltb4r2

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_446092.1 Gene:Ltb4r2 / 114098 RGDID:621029 Length:358 Species:Rattus norvegicus


Alignment Length:387 Identity:98/387 - (25%)
Similarity:160/387 - (41%) Gaps:90/387 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 FEPPKSST-------------FLIMAALYCLISVVGCVGNAFVIFMFAN-RKSLRTP-ANILVMN 157
            :.||.:.|             ||::|||      :|..||.||::..|. |.:...| |..||::
  Rat     5 YRPPGNETLLSWKGSRATGTAFLLLAAL------LGLPGNGFVVWSLAGWRPTAGRPLAATLVLH 63

  Fly   158 LAICDFLMLIKCPIAIYNNIKEGPALGDIACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHP-L 221
            ||:.|..:|:..|:.:....::...||.:.|:...:|..||...::.....::|.|...|..| |
  Rat    64 LALADGAVLLLTPLFVAFLSRQAWPLGQVGCKAVYYVCALSMYASVLLTGLLSLQRCLAVTRPFL 128

  Fly   222 QPLRRCSRLRS----YLIILLIWCYSFLFAVMPALDIGLSVYVPEGFLTTCSFDYLNKEMPARIF 282
            .|     ||||    ..::|.:|..:.:.|| ||     :||........|...: ...:.|...
  Rat   129 AP-----RLRSPALARRLLLGVWLAALVLAV-PA-----AVYRHLWGDRVCQLCH-PSAVHAAAH 181

  Fly   283 MALFFVAAYCIPLTSIVYSYFYILKVVFTASRIQSNK-DKAKTEQKLAFIVAAIIGLWFLAWSPY 346
            ::|..:.|:.:|..:::..|      ..|.:|::..: ...:...::..:|:||:..:.|.|:||
  Rat   182 LSLETLTAFVLPFGTVLGCY------GVTLARLRGARWGSGRQGTRVGRLVSAIVLAFGLLWAPY 240

  Fly   347 -AIVAMMGVFGLERHITPL------------GSMIPALFCKTAACVDPYLYAAT--------HPR 390
             |:..:..|..|.....||            |:...|.|   ::.|:|.||..|        .||
  Rat   241 HAVNLLQAVAALAPPEGPLARLGGAGQAARAGTTALAFF---SSSVNPVLYVFTAGDLLPRAGPR 302

  Fly   391 FRVEVRMLFYGRGVLRRVSTTRSSYMTRSRSSFTHRLRTS----TTGEG-GMGD----HRME 443
            |   :..||.|.|..|..|.:|..         |..|||:    ..|:| |.||    .|||
  Rat   303 F---LTRLFEGSGEARVGSRSREG---------TMELRTTPRLKVVGQGRGYGDPGGGGRME 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 34/128 (27%)
7tm_1 133..384 CDD:278431 64/271 (24%)
Ltb4r2NP_446092.1 7tm_GPCRs 21..300 CDD:421689 73/305 (24%)
TM helix 1 22..48 CDD:410628 11/31 (35%)
TM helix 2 57..82 CDD:410628 8/24 (33%)
TM helix 3 94..124 CDD:410628 6/29 (21%)
TM helix 4 136..156 CDD:410628 4/20 (20%)
TM helix 5 178..203 CDD:410628 5/30 (17%)
TM helix 6 217..247 CDD:410628 8/29 (28%)
TM helix 7 267..292 CDD:410628 7/27 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..358 15/47 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334355
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.