DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and ltb4r2b

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001295899.2 Gene:ltb4r2b / 100537296 ZFINID:ZDB-GENE-070912-658 Length:339 Species:Danio rerio


Alignment Length:343 Identity:83/343 - (24%)
Similarity:137/343 - (39%) Gaps:71/343 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 SSTFLIMAALYCLISV-VGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLMLIKCPIAIYNN 176
            :||.....||...|:: :|..||.|:|:....|...|:...:|::|||..|..::......|...
Zfish    26 NSTSATFGALILSIAILLGIPGNLFIIWSILARARKRSVTTLLILNLAFADGCLMFLTIFFIIYL 90

  Fly   177 IKEGPALGDIACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQPLRRCSRLRSYLIIL-LIW 240
            .|:....|::.|:|..::...:...:|..:|.::|.|...|:.| ..|..|:|..:.|::| .:|
Zfish    91 AKQNWIFGEVLCKLLFYLCNTNMYASIMIITLMSLHRLVAVMWP-SYLSVCTRRLTVLLVLGGLW 154

  Fly   241 CYSFLFAVMPAL------DIGLSVYVPEGFLTTCSFDYLNKEMPARIFMALFFVAAYCIPLTSIV 299
            ...||.| ||.|      .||....|.|        .:.|:...|.....|..:..:.:|...||
Zfish   155 VAVFLLA-MPVLMFRAEKTIGNKRIVCE--------THHNRTEQAVFQYTLETMVGFLVPYVIIV 210

  Fly   300 YSYFYILKVVFTASRIQSNKDK--AKTEQKLAFIVAAIIGLWFLAWSPYAIVAMMGVFGLERHIT 362
            .||..||:      |::..|.|  .::|.    ::.|||..:.:.|.||.|:.::.|...   :|
Zfish   211 SSYVCILR------RLRQTKFKRMIRSEN----LIQAIIVTFCIFWLPYHILNVVQVMAA---LT 262

  Fly   363 PLG--------------SMIPALFCKTAACVDPYLYAATHPRFRVEVRMLFYGRGVLRRVSTTRS 413
            |.|              ..:.:.....::|.:|.|||             |.||           
Zfish   263 PEGMPLKTQLKNIWESSRAVTSTLAFISSCANPVLYA-------------FAGR----------- 303

  Fly   414 SYMTRSRSSFTHRLRTST 431
            ||:.....:|..||...|
Zfish   304 SYIKADGLAFMARLFEGT 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 32/123 (26%)
7tm_1 133..384 CDD:278431 65/273 (24%)
ltb4r2bNP_001295899.2 7tm_1 47..298 CDD:278431 65/273 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573375
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.