DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and LOC100535160

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_003201711.2 Gene:LOC100535160 / 100535160 -ID:- Length:351 Species:Danio rerio


Alignment Length:318 Identity:76/318 - (23%)
Similarity:137/318 - (43%) Gaps:34/318 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 IMAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLMLIKCPIAIYNNIKEGP- 181
            |:.|....:...|.|||..|:.... |.:.:|..::.|.|||:.|.:.:|..|..|:...:.|. 
Zfish    48 ILPAFIGFLCSTGLVGNVLVLVTIL-RSAKKTVPDVYVGNLAVADLVHVIVMPFLIHQWARGGHW 111

  Fly   182 ALGDIACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQPLRRCSRLRSYLIILLIWCYSFLF 246
            ..|...|.:...:...:.......:||::||||..:|||.:.|...:|.|:..|.|.:|..||:.
Zfish   112 VFGSSLCTIITSLDNCNQVACAAVMTAMSLDRYLALVHPFRLLSLRTRSRTIRINLFVWAASFIM 176

  Fly   247 AVMPALDIGLSVYVPEGFLTTCSFDYLNKEMPARIFMALFF--VAAYCIPLTSIVYSYFYILKVV 309
             |:||......:...:| |.:||   ||...|.::.....:  |.::.:||..|:..|..||  .
Zfish   177 -VLPAWVHAKVIRFRDG-LESCS---LNLVSPKQVLWYTLYQTVTSFFLPLPLILTCYILIL--C 234

  Fly   310 FTASRIQSNKDKAKTEQ--------KLAFIVAAIIGLWFLAWSPYAIVAMMGVFGLERHITPLGS 366
            :|....:.||...:...        :|..:|..::.::.::..||.|:.::.:      ..|..|
Zfish   235 YTWRMYRKNKKAHRYNTSLPRERVVRLTKMVLVLVAVFLVSVGPYHILQLVNL------SVPRPS 293

  Fly   367 M-------IPALFCKTAACVDPYLY--AATHPRFRVEVRMLFYGRGVLRRVSTTRSSY 415
            :       :.......|:.::|::|  .:.|.|.|:..|.......|.|.:...|||:
Zfish   294 LAYHTCYYLSVCLSYAASSINPFIYILLSGHFRHRLVCRDTPSMPSVEREIQAPRSSF 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 35/122 (29%)
7tm_1 133..384 CDD:278431 62/268 (23%)
LOC100535160XP_003201711.2 7tmA_MCHR2 47..329 CDD:320461 69/294 (23%)
TM helix 1 48..74 CDD:320461 7/26 (27%)
TM helix 2 80..106 CDD:320461 8/25 (32%)
TM helix 3 118..148 CDD:320461 7/29 (24%)
TM helix 4 160..180 CDD:320461 7/20 (35%)
TM helix 5 206..235 CDD:320461 7/30 (23%)
TM helix 6 256..286 CDD:320461 5/29 (17%)
TM helix 7 297..322 CDD:320461 3/24 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.