DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and si:zfos-169g10.2

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_009300354.1 Gene:si:zfos-169g10.2 / 100334518 ZFINID:ZDB-GENE-120215-119 Length:429 Species:Danio rerio


Alignment Length:431 Identity:107/431 - (24%)
Similarity:171/431 - (39%) Gaps:96/431 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 HDKHVNDSVSTGLSNYSNYPSYIHYRDKYDLSYIAKVNPFWLQFEPPKSSTFLIMAALYCLISVV 129
            |......|:.|..|:..| .::|...|.            |...:.......:::..:|..:.||
Zfish    12 HPSTTQPSMCTNASSSPN-QTFISPTDN------------WRPLDYSPGIAGILIPLVYITVCVV 63

  Fly   130 GCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLMLIKCP-IAIYNNIKEGPALGDIACRLYGF 193
            |.|||..||.:........:..||.::||||.|.|.::..| :|:.|.:...| .|.:.|||...
Zfish    64 GLVGNTLVIHIVLRYSQAESVTNIYILNLAIADELFMLGLPFLAVQNGLLSWP-FGSLMCRLVMT 127

  Fly   194 VGGLSGTCAIGTLTAIALDRYNVVVHPLQPLRRCSRLR----SYLIILLIWCYSFLFAVMPAL-- 252
            |..::...:|..||.:::|||..|||||    |.||.|    :..:...||..||: .|:|.:  
Zfish   128 VDAINQFTSIFCLTVMSIDRYLAVVHPL----RSSRWRQPRVAKTVNCTIWAISFV-VVLPVVVF 187

  Fly   253 ------DIGLSVYVPEGFLTTCSFDYLNKEMPARIFMALFFVAAYCI----PLTSIVYSYFYI-L 306
                  |...|:..||               ||.::.|.|.:....:    |||.|...|..| :
Zfish   188 AGVLQDDGNCSIVWPE---------------PAEVWKASFIIYTATVGFFGPLTVICLCYLLIVV 237

  Fly   307 KVVFTASRIQSNK-DKAKTEQKLAFIVAAIIGLWFLAWSPY-------AIVAMMGVF-GLERHIT 362
            ||..:..|:::.. .:.|:|:|:..:|..::.::...|.|:       .:|.:.|.| ||...:.
Zfish   238 KVRSSGRRVRATSIRRRKSERKITRMVVIVVAVFVFCWLPFYVLNIVNLLVLLPGEFRGLYYFVV 302

  Fly   363 PLGSMIPALFCKTAACVDPYLYAATHPRFRVEVRMLFYGRGVLRRVSTTRSSYMTRSRSSFTHRL 427
            .|.        ...:|.:|.||......|:         ||.  |.:..|||          .|:
Zfish   303 VLS--------YANSCANPILYGFLSDNFK---------RGF--RKALCRSS----------RRV 338

  Fly   428 RTSTTGEG-GM-----GDHRMENYLMNNNLMMVPEETEENE 462
            ......:| ||     .:.|.|..:..:...|..||.||:|
Zfish   339 ENQDLQQGTGMVALPLEEIRREMEVKEHLKAMDVEEREESE 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 44/126 (35%)
7tm_1 133..384 CDD:278431 73/277 (26%)
si:zfos-169g10.2XP_009300354.1 7tm_4 58..>259 CDD:304433 65/221 (29%)
7tm_1 67..316 CDD:278431 73/277 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573358
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.