DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrx-IV and CG10280

DIOPT Version :9

Sequence 1:NP_524034.2 Gene:Nrx-IV / 39387 FlyBaseID:FBgn0013997 Length:1284 Species:Drosophila melanogaster
Sequence 2:NP_001246942.1 Gene:CG10280 / 40740 FlyBaseID:FBgn0037395 Length:362 Species:Drosophila melanogaster


Alignment Length:360 Identity:73/360 - (20%)
Similarity:110/360 - (30%) Gaps:136/360 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   751 GGDIREKEYLPVRAVKFGDTGTPLDEKMGRYTLGPLRCEGDDLFSNVVTFRIADASINLP-PFDM 814
            |.|..|.|:..|..|.     .||.::...|  ||  ..|||           |..|:.| ....
  Fly    75 GVDFFEHEFTSVAEVL-----KPLSDEYDPY--GP--DIGDD-----------DLGIDDPETMPR 119

  Fly   815 GHSGDIYLEFRTTQENSVIFHATGPTDYIKLSLNGGNKLQFQYQAGSGPLGVNVGTSYHLNDNNW 879
            ...|||               |..|..||.|.|            |..|:               
  Fly   120 LFQGDI---------------AIDPYTYITLRL------------GVNPM--------------- 142

  Fly   880 HTVSVERNRKEARLVVDGSIKAEVREPPGPVRALHLTSDLVIGATTEYRDGYVGCIRALLLNGKM 944
                    |...||..:|:|..|:..     |..:.....:|.|...:..  :.|:..:..:|::
  Fly   143 --------RHPKRLWPNGTIPFEISP-----RYANQERQAIIQAVKTFNS--LTCVHFVPYDGEV 192

  Fly   945 VD--LKEYSKRGLYGISTGC---VGRCESNPCLNNGTCIERYDGYSCDCRWSAFKGPICAD---E 1001
            .|  |.|....|    ..||   |||......::    ::|.|..|..|..|  :|.|..:   .
  Fly   193 DDYLLIEPPLEG----PQGCWSYVGRRGGEQVVS----LQRPDENSAHCFSS--EGRIMHELMHA 247

  Fly  1002 IGVNLRSSSIIRYEFEGSFRSTIAENIRVGFTTTIP---KGFLLGFSSNLTGEYLTIQISNSGHL 1063
            ||:....|...|..|           :::.:...:|   |.|.|  .|...|:|           
  Fly   248 IGIYHEQSRADRDNF-----------VKIHWDNIVPRFRKNFKL--VSKKKGKY----------- 288

  Fly  1064 RCVFDFGFERQEIIFPKKHFGLGQYHDMHFMRKNG 1098
              .||:.:.      ...|:|     :.:|.::.|
  Fly   289 --AFDYDYN------SVMHYG-----EFYFSKRKG 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nrx-IVNP_524034.2 FA58C 46..185 CDD:214572
FA58C 57..184 CDD:238014
LamG 192..340 CDD:238058
LamG 376..514 CDD:238058
EGF 546..575 CDD:278437
Laminin_G_2 824..943 CDD:280389 18/118 (15%)
EGF_CA 966..998 CDD:238011 6/31 (19%)
Laminin_G_2 1032..1156 CDD:280389 13/70 (19%)
4.1m 1239..1255 CDD:128590
CG10280NP_001246942.1 Astacin 147..344 CDD:279708 44/218 (20%)
ZnMc_astacin_like 151..342 CDD:239807 42/214 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444920
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.