DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrx-IV and CG15253

DIOPT Version :9

Sequence 1:NP_524034.2 Gene:Nrx-IV / 39387 FlyBaseID:FBgn0013997 Length:1284 Species:Drosophila melanogaster
Sequence 2:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster


Alignment Length:164 Identity:38/164 - (23%)
Similarity:63/164 - (38%) Gaps:43/164 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   976 TCIERYDGYSCDCRWSAFKGPICADEIGVNLRSSSIIRYEFEGSFRSTIA----------ENIRV 1030
            :.|::.:..||    ..||......:..||:.|.       ||...|.|.          :|..:
  Fly    80 SAIQKIESISC----LTFKEATTDQKYYVNVTSE-------EGGCFSYIGYLNRVQQLNLQNNEI 133

  Fly  1031 GF----TTTIPKGFL--LGF----SSNLTGEYLTIQISN--SGHLRCVFDFGFER--QEII--FP 1079
            |.    ..||...||  |||    |:....:|:.|...|  .|     .:|.|::  :|.:  |.
  Fly   134 GVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEG-----MEFNFDKYTEETVNDFG 193

  Fly  1080 KKH-FGLGQYHDMHFMRKNGGSTVVLKVDNYEPV 1112
            :|: :|...::..:...|||..|::...:..|.|
  Fly   194 EKYDYGSVMHYGPYAFSKNGERTILALEEGKEDV 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nrx-IVNP_524034.2 FA58C 46..185 CDD:214572
FA58C 57..184 CDD:238014
LamG 192..340 CDD:238058
LamG 376..514 CDD:238058
EGF 546..575 CDD:278437
Laminin_G_2 824..943 CDD:280389
EGF_CA 966..998 CDD:238011 5/21 (24%)
Laminin_G_2 1032..1156 CDD:280389 24/98 (24%)
4.1m 1239..1255 CDD:128590
CG15253NP_609758.1 Astacin 55..250 CDD:279708 38/164 (23%)
ZnMc_astacin_like 59..246 CDD:239807 38/164 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444938
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.