DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrx-IV and CG15254

DIOPT Version :9

Sequence 1:NP_524034.2 Gene:Nrx-IV / 39387 FlyBaseID:FBgn0013997 Length:1284 Species:Drosophila melanogaster
Sequence 2:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster


Alignment Length:269 Identity:48/269 - (17%)
Similarity:89/269 - (33%) Gaps:81/269 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 SEPQMFKGNSDGNSIHYNVFEVPIIAQWVRINPTRWHDRISMRVELYGCDYISENLYFNGTGLVR 201
            ::|::..|..:|:.:     ..|.....:|....||.:||                       |.
  Fly    29 TDPELTAGYIEGDMV-----PSPEGRNGLRNETFRWPNRI-----------------------VY 65

  Fly   202 YDLRREPITSTKESIRFRFKTAFANGVMMYSRGTQ-------------GDYYALQLKDNKMVLNL 253
            |.:.|:..|..:..|....:....:..:::...|.             |.|..:..::....|||
  Fly    66 YYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGGCYSYVGYRNRVQQLNL 130

  Fly   254 D----------LGSRVMTSL-SVGSLLDDNVWHDVVISRNQRDIIFSVDRVIVRGRIQGEFTRLN 307
            .          ||:.|...| ::|.....:.|       |:.|.:...:..|..| .:|.|.:.:
  Fly   131 QTYALDTGCFRLGTIVHEFLHALGFYHQQSTW-------NRDDYVRIAEENITEG-TEGNFNKYD 187

  Fly   308 LNRELYLGGVPNVQEGLIVQQNFSGCLE-NIYFNSTN----FIRVMKDSTEL-GEGYLFT----- 361
             |..:...|.|         .::|..|. ..|..|.|    .:.:.:.:.|| |:....|     
  Fly   188 -NETVEDYGEP---------YDYSSVLHYTAYAFSKNGEMTIVPLQEGAEELMGQRLQMTQSDIN 242

  Fly   362 RVNTIYACP 370
            ::|.:|.||
  Fly   243 KLNVMYKCP 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nrx-IVNP_524034.2 FA58C 46..185 CDD:214572 9/47 (19%)
FA58C 57..184 CDD:238014 9/46 (20%)
LamG 192..340 CDD:238058 29/172 (17%)
LamG 376..514 CDD:238058
EGF 546..575 CDD:278437
Laminin_G_2 824..943 CDD:280389
EGF_CA 966..998 CDD:238011
Laminin_G_2 1032..1156 CDD:280389
4.1m 1239..1255 CDD:128590
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 41/233 (18%)
ZnMc_astacin_like 61..248 CDD:239807 38/227 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444939
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.