DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrx-IV and Semp1

DIOPT Version :9

Sequence 1:NP_524034.2 Gene:Nrx-IV / 39387 FlyBaseID:FBgn0013997 Length:1284 Species:Drosophila melanogaster
Sequence 2:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster


Alignment Length:207 Identity:37/207 - (17%)
Similarity:66/207 - (31%) Gaps:73/207 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 DRVIVRGRIQGEF------TRLNLNRELYLGGVPN------VQEGLIVQQNFSGCLENIYFNSTN 343
            |..::.|..||:.      ||..:..::|  ..||      :::......::...|..|.....|
  Fly    23 DPELLAGFYQGDIKAHPIRTRNGIVNQIY--HWPNRTVPYMIEDDAFADSHYREILRAISIIEEN 85

  Fly   344 FIRVMKDSTELGEGYLFTRVNTIYACPSPPIYPVTFTTRS-----SFVRLKGYEN-SQRLNVSFY 402
            ...:.|.:||:.                   :|:.....|     :.|.| ||.| :|.:|:..|
  Fly    86 SCVIFKPATEMD-------------------FPMALVITSKGLGCNTVHL-GYRNKTQVVNLEIY 130

  Fly   403 ------FRT------------YEETGVMLHHDFYSGGYLKVFLEFGKVKIDLKVKDKARIILDNY 449
                  ||.            :|...|..:.|.|      |.:::..:.....:         |:
  Fly   131 PLGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQY------VSIQWKNINPQYNI---------NF 180

  Fly   450 DDQFNDGKWHSF 461
            .:..|...||.|
  Fly   181 VNNDNSTAWHDF 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nrx-IVNP_524034.2 FA58C 46..185 CDD:214572
FA58C 57..184 CDD:238014
LamG 192..340 CDD:238058 11/60 (18%)
LamG 376..514 CDD:238058 22/110 (20%)
EGF 546..575 CDD:278437
Laminin_G_2 824..943 CDD:280389
EGF_CA 966..998 CDD:238011
Laminin_G_2 1032..1156 CDD:280389
4.1m 1239..1255 CDD:128590
Semp1NP_609756.1 Astacin 53..249 CDD:279708 30/175 (17%)
ZnMc_astacin_like 55..245 CDD:239807 29/173 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444837
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.