DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrx-IV and CG15255

DIOPT Version :9

Sequence 1:NP_524034.2 Gene:Nrx-IV / 39387 FlyBaseID:FBgn0013997 Length:1284 Species:Drosophila melanogaster
Sequence 2:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster


Alignment Length:230 Identity:48/230 - (20%)
Similarity:73/230 - (31%) Gaps:76/230 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   796 NVVTFRIADASINLPPFDMGHSGDIY-----------LEFR-TTQENSVIFHATGPTDYIKLSLN 848
            |||.:||:|      .||..|...|.           |.|| .|.|:......|        :.:
  Fly    71 NVVVYRISD------DFDTAHKKAIQTGIDTLELHTCLRFREATDEDKAYLTVT--------AKS 121

  Fly   849 GGNKLQFQYQAGSGPLGVNVGTSYHLNDNNWHTVSVERNRKEARLVVDGSIKAEVREPPGPVRAL 913
            ||......||.....:.:.:   |.|.:..:.               .|:|..|.....|   ..
  Fly   122 GGCYTAVGYQGAPQEMNLEI---YPLGEGCFR---------------PGTILHEFMHALG---FY 165

  Fly   914 HLTSDLVIGATTEYRDGYVGCIRALLLNGKMVDLKEYSKRGLYGISTGCVGRCESNPCLNNGTCI 978
            |..|..:       ||.::..|...::.||..:.::|:...:.....|                 
  Fly   166 HQQSSSI-------RDDFINVIYENIVPGKEFNFQKYADTVVTDFEVG----------------- 206

  Fly   979 ERYDGYSC-DCRWSAFKGPICADEIGVNLRSSSII 1012
              ||..|| ..|..||.  |..::..|.|.||::|
  Fly   207 --YDYDSCLHYRPGAFS--INGEDTIVPLDSSAVI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nrx-IVNP_524034.2 FA58C 46..185 CDD:214572
FA58C 57..184 CDD:238014
LamG 192..340 CDD:238058
LamG 376..514 CDD:238058
EGF 546..575 CDD:278437
Laminin_G_2 824..943 CDD:280389 20/119 (17%)
EGF_CA 966..998 CDD:238011 7/32 (22%)
Laminin_G_2 1032..1156 CDD:280389
4.1m 1239..1255 CDD:128590
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 48/230 (21%)
ZnMc_astacin_like 70..255 CDD:239807 48/230 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444930
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.