DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP68F and BAG7

DIOPT Version :9

Sequence 1:NP_001261744.1 Gene:RhoGAP68F / 39385 FlyBaseID:FBgn0036257 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_014777.3 Gene:BAG7 / 854302 SGDID:S000005660 Length:409 Species:Saccharomyces cerevisiae


Alignment Length:250 Identity:65/250 - (26%)
Similarity:111/250 - (44%) Gaps:34/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 PSRKPSTPP-PSSNINASRQQQHKMATTH--------QFGVPLK----------FIVMNSPCLNS 290
            ||.:..:|. .||::::...::.:...|:        .|||.|:          .|..::..:.|
Yeast    10 PSSEEGSPQNRSSSMSSVEGKKDRDTFTNLQNEFDGKVFGVSLEESLKVAQEEVIIQKSTNEIGS 74

  Fly   291 IPPIVRKCVDSLSITGVIDTEGIFRRSGNHSEIMALKERVNRGEDVDLK-----SVNVHVIAGLL 350
            ||.::.|....|. ...:||.||||.:|::..:..|:...::..|...|     ..|||.||.||
Yeast    75 IPVVIAKSGKYLK-ENALDTTGIFRIAGSNKRVRELQAVFSKPPDYGRKFEGWCDFNVHDIATLL 138

  Fly   351 KSFLRDLAEPLLTFELYEDVTG-FLDWPKEERSRNVTQLIRE------KLPEENYELFKYIVEFL 408
            |.:|..|:|||:...||:.... .|:.||....:.  |:|::      .||::|..|..|:...|
Yeast   139 KRYLNSLSEPLVPLALYDIFRNPILENPKINEHKE--QIIKDYEDIYMLLPQQNRHLILYLAALL 201

  Fly   409 VRVMDCEDLNKMTSSNLAIVFGPNFLWSRSTSTSLEEIAPINAFVDFVLQNHKDI 463
            ......|..|.|::||||.:..|:.|.........:|.......::|::.:..||
Yeast   202 NLFARNEKKNLMSASNLAAIVQPSLLSHPKDEMCPKEYEASRTVIEFLILHASDI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP68FNP_001261744.1 SEC14 105..233 CDD:238099
RhoGAP-p50rhoGAP 269..464 CDD:239869 59/224 (26%)
BAG7NP_014777.3 RhoGAP_fSAC7_BAG7 47..257 CDD:239861 58/212 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2980
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.