DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP68F and AT1G08340

DIOPT Version :9

Sequence 1:NP_001261744.1 Gene:RhoGAP68F / 39385 FlyBaseID:FBgn0036257 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_172310.1 Gene:AT1G08340 / 837354 AraportID:AT1G08340 Length:331 Species:Arabidopsis thaliana


Alignment Length:217 Identity:56/217 - (25%)
Similarity:95/217 - (43%) Gaps:37/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 DNICDLDDKLNPSRKPSTPPPSSNINASRQQQHKMATTHQFGVPLKFIVMNSPCLNSIPPIVRKC 298
            |....|..:..|......|..|:.:               |||..:.:.::.....:..|::...
plant    21 DGFLGLPSEFEPDVPRKAPSASATV---------------FGVSTESMQLSYDSRGNCVPVILLL 70

  Fly   299 VDS-LSITGVIDTEGIFRRSGNHSEIMALKERVNRGEDVDLKSVNVHVIAGLLKSFLRDLAEPLL 362
            :.| |...|.:..||:||.:|.:||...::|::|:|...|  .::||.:|||:|::.|:|..   
plant    71 LQSRLYDQGGLQAEGVFRITGENSEEEFVREQLNKGIIPD--GIDVHCLAGLIKAWFRELPR--- 130

  Fly   363 TFELYEDVTGFLD-WPKE-----ERSRNVTQLIREKLPEENYELFKYIVEFLVRVMDCEDLNKMT 421
                     |.|| .|.|     |...:..:::| .||:....|..:.:..:..|:..|.:|||.
plant   131 ---------GVLDPLPSEQVMQCESDEDFVKVVR-LLPQTEASLLNWAINLMADVIQFEHVNKMN 185

  Fly   422 SSNLAIVFGPNFLWSRSTSTSL 443
            |.|||:||.||........|:|
plant   186 SRNLALVFAPNMSQMADPLTAL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP68FNP_001261744.1 SEC14 105..233 CDD:238099
RhoGAP-p50rhoGAP 269..464 CDD:239869 51/182 (28%)
AT1G08340NP_172310.1 PBD 3..37 CDD:197628 3/15 (20%)
RhoGAP 65..217 CDD:238090 48/158 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.