DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP68F and AT1G08340

DIOPT Version :10

Sequence 1:NP_001401037.1 Gene:RhoGAP68F / 39385 FlyBaseID:FBgn0036257 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_172310.1 Gene:AT1G08340 / 837354 AraportID:AT1G08340 Length:331 Species:Arabidopsis thaliana


Alignment Length:217 Identity:56/217 - (25%)
Similarity:95/217 - (43%) Gaps:37/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 DNICDLDDKLNPSRKPSTPPPSSNINASRQQQHKMATTHQFGVPLKFIVMNSPCLNSIPPIVRKC 307
            |....|..:..|......|..|:.:               |||..:.:.::.....:..|::...
plant    21 DGFLGLPSEFEPDVPRKAPSASATV---------------FGVSTESMQLSYDSRGNCVPVILLL 70

  Fly   308 VDS-LSITGVIDTEGIFRRSGNHSEIMALKERVNRGEDVDLKSVNVHVIAGLLKSFLRDLAEPLL 371
            :.| |...|.:..||:||.:|.:||...::|::|:|...|  .::||.:|||:|::.|:|..   
plant    71 LQSRLYDQGGLQAEGVFRITGENSEEEFVREQLNKGIIPD--GIDVHCLAGLIKAWFRELPR--- 130

  Fly   372 TFELYEDVTGFLD-WPKE-----ERSRNVTQLIREKLPEENYELFKYIVEFLVRVMDCEDLNKMT 430
                     |.|| .|.|     |...:..:::| .||:....|..:.:..:..|:..|.:|||.
plant   131 ---------GVLDPLPSEQVMQCESDEDFVKVVR-LLPQTEASLLNWAINLMADVIQFEHVNKMN 185

  Fly   431 SSNLAIVFGPNFLWSRSTSTSL 452
            |.|||:||.||........|:|
plant   186 SRNLALVFAPNMSQMADPLTAL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP68FNP_001401037.1 CRAL_TRIO_2 119..242 CDD:463965
RhoGAP-p50rhoGAP 278..473 CDD:239869 51/182 (28%)
AT1G08340NP_172310.1 PBD 3..37 CDD:197628 3/15 (20%)
RhoGAP 65..217 CDD:238090 48/158 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.