DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP68F and AT5G61530

DIOPT Version :9

Sequence 1:NP_001261744.1 Gene:RhoGAP68F / 39385 FlyBaseID:FBgn0036257 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001190587.1 Gene:AT5G61530 / 836274 AraportID:AT5G61530 Length:376 Species:Arabidopsis thaliana


Alignment Length:296 Identity:70/296 - (23%)
Similarity:123/296 - (41%) Gaps:69/296 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 LDELRQALGLNKLKLPDNICDLDDKLNPSRKPSTPPPSSNINASRQQQHKMATTHQFGVPLKFIV 282
            :.|.::.:.:.|:|:.:           :.|.:.....:.:....:.|..:|::..|||.::..|
plant    92 ITETKEKVSVGKIKVEE-----------AAKKTAQKSKTILTDIERWQKGVASSDVFGVAIEITV 145

  Fly   283 MNSPCLNSIPPIVRKCVDSLSITGVIDTEGIFRRSGNHSEIMALKERVNRGEDVDL-KSVNVHVI 346
            ........||.|:.||.|.|.:|| :::..:|:..|:...|..|....|:.....: :.||...:
plant   146 QRQESSRPIPLILVKCADYLILTG-LNSPNLFKAEGDRKLIQQLVSAYNQDPRASIPEGVNPVDV 209

  Fly   347 AGLLKSFLRDLAEPLLTFELYEDVTGFLDWPKEERS--RNVTQLIREKLPEENYELFKYIVEFLV 409
            |.|||.:|..|..||.|||||.::       |:.||  ..:.|.: :||...||...::|...|:
plant   210 AALLKYYLASLPTPLTTFELYNEI-------KDARSSIHRMRQSL-QKLSNVNYNTLEFITALLL 266

  Fly   410 RVMDCEDLNKMTSSNLAIVFGPNFLW----------------SR--------------------- 437
            ||.....||||.|.:||:...|..:|                ||                     
plant   267 RVSQKSLLNKMDSHSLAMEMAPVIMWREDNRPESYREYWRRPSRSPKKSNDFETATPWDLLSDEG 331

  Fly   438 -----STSTSLEEIAPIN----AFVDFVLQNHKDIY 464
                 |:|..|::||.::    ..|..::::|..|:
plant   332 EGPDASSSIPLDDIARVDFGAVEVVQCLIEHHNAIF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP68FNP_001261744.1 SEC14 105..233 CDD:238099 3/14 (21%)
RhoGAP-p50rhoGAP 269..464 CDD:239869 64/243 (26%)
AT5G61530NP_001190587.1 RhoGAP 155..299 CDD:279014 49/152 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I3434
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002972
OrthoInspector 1 1.000 - - oto3111
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.