DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP68F and si:ch211-247j9.1

DIOPT Version :10

Sequence 1:NP_001401037.1 Gene:RhoGAP68F / 39385 FlyBaseID:FBgn0036257 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_005161458.2 Gene:si:ch211-247j9.1 / 570019 ZFINID:ZDB-GENE-091204-212 Length:647 Species:Danio rerio


Alignment Length:172 Identity:62/172 - (36%)
Similarity:93/172 - (54%) Gaps:12/172 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 PPIVRKCVDSLSITGVIDTEGIFRRSGNHSEIMALKERVNRGEDVDL-KSVNVHVIAGLLKSFLR 364
            |.:|.:|||.:...|:.:. |:||:.|..:.:..|:|..:.||.... .|.:||.:|.|||.:||
Zfish    79 PLVVEQCVDFIRERGLTEV-GLFRQPGQATLVKELQEAFDAGEKPSFDSSTDVHTVASLLKLYLR 142

  Fly   365 DLAEPLLTFELYEDVTGFLDWPK---EERSRNVTQL--IREKLPEENYELFKYIVEFLVRVMDCE 424
            :|.|||:.|..||:   ||...|   .:|.:.:.:|  :..:||..|:.|.|||.:||..|....
Zfish   143 ELPEPLVPFSRYEE---FLVCGKRIPSDREKGLQELRSLLYELPVANFNLLKYICQFLNDVQSYS 204

  Fly   425 DLNKMTSSNLAIVFGPNFLWSRSTSTSLEEIAPINAFVDFVL 466
            ::|||:..|||.|||||.|  |..:...|.|....|.|..::
Zfish   205 NVNKMSIQNLATVFGPNIL--RPKAEDPESIIGGAAVVQHIM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP68FNP_001401037.1 CRAL_TRIO_2 119..242 CDD:463965
RhoGAP-p50rhoGAP 278..473 CDD:239869 62/172 (36%)
si:ch211-247j9.1XP_005161458.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.