DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP68F and RhoGAP92B

DIOPT Version :9

Sequence 1:NP_001261744.1 Gene:RhoGAP68F / 39385 FlyBaseID:FBgn0036257 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001287417.1 Gene:RhoGAP92B / 42371 FlyBaseID:FBgn0038747 Length:740 Species:Drosophila melanogaster


Alignment Length:250 Identity:79/250 - (31%)
Similarity:113/250 - (45%) Gaps:19/250 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 LDELRQALGLNKLKL---PDNI--CDLDDKLNPSRKPSTPPPSSNINASRQQQHKMAT-THQFGV 276
            |::.|.|.....|:|   .|.|  |..|..||............|.:.:|.|.....| ..:||.
  Fly   187 LEKERDAWAAQMLELIAKEDEIVSCIRDYVLNQRNYHERALQHVNASLARIQDTIQGTEKSRFGT 251

  Fly   277 PLKFIVMNSPCLNSIPPIVRKCVDSLSITGVIDTEGIFRRSGNHSEIMALK---ERVNRGEDVDL 338
            .||..:.::.  ..|..||..|...|...| ::.||:.|.....:::..:|   |..:....:.|
  Fly   252 SLKEHLTSTN--REISYIVELCCCCLLEHG-LEEEGLLRVGCASTKLRRMKHALEAQHVKTPLPL 313

  Fly   339 KSVNVHVIAGLLKSFLRDLAEPLLTFELYEDVTGFLDWPKEERSRNVTQLIREKLPEENYELFKY 403
            ...:.|||..:||.:||:|.|||||:.||:|.....:...|...:...:.|..|||:|||...:|
  Fly   314 DYQDPHVIGSILKLYLRELPEPLLTYNLYKDFIRIAERHSEAERKTEIKAILTKLPKENYANLRY 378

  Fly   404 IVEFLVRVMDCEDLNKMTSSNLAIVFGPNFLWSRSTSTSLEEIAPINAFVDFVLQ 458
            :..||..|.....||||:|.|||||..||.||.|...:|       ||..|::.|
  Fly   379 LTRFLSIVQQRSALNKMSSQNLAIVMSPNMLWPRIDKSS-------NAPADYIGQ 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP68FNP_001261744.1 SEC14 105..233 CDD:238099 5/17 (29%)
RhoGAP-p50rhoGAP 269..464 CDD:239869 64/193 (33%)
RhoGAP92BNP_001287417.1 BAR 27..257 CDD:299863 19/69 (28%)
RhoGAP_nadrin 245..452 CDD:239851 63/191 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I3434
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1511935at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.