Sequence 1: | NP_001261744.1 | Gene: | RhoGAP68F / 39385 | FlyBaseID: | FBgn0036257 | Length: | 476 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001012121.1 | Gene: | Prr5 / 315189 | RGDID: | 1307954 | Length: | 387 | Species: | Rattus norvegicus |
Alignment Length: | 290 | Identity: | 55/290 - (18%) |
---|---|---|---|
Similarity: | 100/290 - (34%) | Gaps: | 86/290 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 142 VENDYILVYFHQGLKEDNKPSAQFLWNSYKELDRNFRKNLKTLYVVHPTWFIRVIWNFFSPFISD 206
Fly 207 KFRKKLVYISSLDELRQALGLNKLKLPDNICDLDDKLNPSRKPSTPPPSSNINASRQQQHKMATT 271
Fly 272 H-----QFGVPLKFIVMNS-PCLNSIPPIVRKCVDSLSITGV----------------------- 307
Fly 308 -IDTEGIFRRSG--NHSEIMALKERVNRGEDVDLKSVNVHVIAGLLKSFLRDLAEPLLTFEL--- 366
Fly 367 -----------YEDVT------GFLDWPKE 379 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoGAP68F | NP_001261744.1 | SEC14 | 105..233 | CDD:238099 | 19/90 (21%) |
RhoGAP-p50rhoGAP | 269..464 | CDD:239869 | 32/163 (20%) | ||
Prr5 | NP_001012121.1 | Interaction with RICTOR. /evidence=ECO:0000250|UniProtKB:P85299 | 10..96 | 13/69 (19%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 11..33 | ||||
HbrB | 40..159 | CDD:285710 | 25/136 (18%) | ||
Interaction with RICTOR. /evidence=ECO:0000250|UniProtKB:P85299 | 189..219 | 2/29 (7%) | |||
PHA03326 | <224..326 | CDD:223045 | 18/83 (22%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 262..347 | 7/41 (17%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 365..387 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4406 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |