DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP68F and RhoGAP5A

DIOPT Version :10

Sequence 1:NP_001401037.1 Gene:RhoGAP68F / 39385 FlyBaseID:FBgn0036257 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster


Alignment Length:188 Identity:68/188 - (36%)
Similarity:102/188 - (54%) Gaps:13/188 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 FGVPLKFIVMNSPCLNSIPPIVRKCVDSLSITGVIDTEGIFRRSGNHSEIMALKERVNR-GEDVD 346
            ||..|..:|...| .:.||.:||:||:.:...|::. |||:|.||...||.|||..::| ||..|
  Fly   302 FGTDLTTMVQLEP-HHQIPFVVRRCVEEVEARGMLQ-EGIYRVSGFADEIEALKLALDREGEKTD 364

  Fly   347 LKSV---NVHVIAGLLKSFLRDLAEPLLTFELYEDVTGFLDWPKEERSRNVTQLIRE---KLPEE 405
            :...   ||:||||.||.:||.|..||:||:.|   ..|:...:..:.....||:.|   :||..
  Fly   365 MSETAYGNVNVIAGTLKLYLRLLPVPLITFQAY---PSFMAAGRTGKQAEQRQLMAEAVRRLPPA 426

  Fly   406 NYELFKYIVEFLVRVMDCEDLNKMTSSNLAIVFGPNFLWSRSTSTSL-EEIAPINAFV 462
            ::...:|::|.|.||.....:|||...|||.||.|..:.:....|:| |||..:::.:
  Fly   427 HHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQHMTNLTEEIFMLSSLI 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP68FNP_001401037.1 CRAL_TRIO_2 119..242 CDD:463965
RhoGAP-p50rhoGAP 278..473 CDD:239869 68/188 (36%)
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_CHN 241..293 CDD:410356
RhoGAP_chimaerin 302..491 CDD:239837 68/188 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.