DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP68F and chin-1

DIOPT Version :10

Sequence 1:NP_001401037.1 Gene:RhoGAP68F / 39385 FlyBaseID:FBgn0036257 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_497323.3 Gene:chin-1 / 175268 WormBaseID:WBGene00015267 Length:421 Species:Caenorhabditis elegans


Alignment Length:205 Identity:57/205 - (27%)
Similarity:97/205 - (47%) Gaps:24/205 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 FGVPLKFIVMNSPCLNSIPPIVRKCVDSLSITGVIDTEGIFRRSGNHSEIMALKERVNRGEDVDL 347
            |||.:..:.|....  .:||||..|:..:...| :|.|||:|.||::..:..||::.:..:.|||
 Worm   232 FGVDITTLCMAHGA--DLPPIVPLCIGEVESRG-LDVEGIYRVSGSYDHMEKLKQQFDSNQYVDL 293

  Fly   348 KSV-NVHVIAGLLKSFLRDLAEPLLTFELYEDVTGFLDWPKE----ERSRNVTQLIREKLPEENY 407
            .:| ::|.:.||||.:.|.|.:.|:.|.:::.:........:    ||.|.:.:::.| |.:.|.
 Worm   294 ATVCDIHTVCGLLKLYFRLLPQQLIPFSVHKQLLVAYQETNQRSTHERERQIRKVMME-LSDANI 357

  Fly   408 ELFKYIVEFLVRVMDCEDLNKMTSSNLAIVFGPNFLWSRSTSTSLEEIAPINAFVDFVLQNHKDI 472
            .....::..|.:|.|....||||..|||.:|.|....|.|..               .:.||:.:
 Worm   358 ITLGAVLAHLKKVADHSAKNKMTVENLATIFSPTLFCSGSIP---------------AMPNHQLL 407

  Fly   473 YLIDVNQRTV 482
            :.:..|.|.|
 Worm   408 HFLINNPRVV 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP68FNP_001401037.1 CRAL_TRIO_2 119..242 CDD:463965
RhoGAP-p50rhoGAP 278..473 CDD:239869 54/194 (28%)
chin-1NP_497323.3 SH2_a2chimerin_b2chimerin 43..130 CDD:198215
C1_CHN 171..223 CDD:410356
RhoGAP 248..413 CDD:238090 50/181 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.