DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP68F and spv-1

DIOPT Version :10

Sequence 1:NP_001401037.1 Gene:RhoGAP68F / 39385 FlyBaseID:FBgn0036257 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_495666.4 Gene:spv-1 / 174278 WormBaseID:WBGene00014051 Length:966 Species:Caenorhabditis elegans


Alignment Length:216 Identity:74/216 - (34%)
Similarity:111/216 - (51%) Gaps:25/216 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 THQFGVPLKFIVMNSPCLNSIPPIVRKCVDSLSITGVIDTEGIFRRSGNHS---EIMALKERVNR 341
            |..||||||.::.:..  ..||.|:.|.:|.|...| :..:||:|..|..|   ||....||.:.
 Worm   594 TSIFGVPLKGLLEHQN--RHIPLIIEKSIDQLQRRG-LRAKGIYRTCGVKSKIEEICNAFERSSS 655

  Fly   342 GEDVDLKSVNVHVIAGLLKSFLRDLAEPLLTFELYED------------VTGFLDWPKEERSRNV 394
            .::|.|.:.|...:|.::|.:||.|.|||||||||:|            .:|  ...:|||...:
 Worm   656 DDEVCLDNENPMNLASVVKLYLRKLPEPLLTFELYDDFVRLGTECCSAQASG--SNCEEERVEQL 718

  Fly   395 TQLIREKLPEENYELFKYIVEFLVRVMDCEDLNKMTSSNLAIVFGPNFLW---SRSTSTS-LEEI 455
            .||.| |||..|||..|:|:..|.||....::|.|::|||:.|..|:.:|   .|...|| :...
 Worm   719 RQLAR-KLPVHNYETLKFIMLHLNRVSWFHEVNLMSTSNLSTVIAPSLIWMSPKRIDHTSAIMHT 782

  Fly   456 APINAFVDFVLQNHKDIYLID 476
            ...|..::.:::|...|:.:|
 Worm   783 QYTNKAIEVMIRNSYHIFGMD 803

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP68FNP_001401037.1 CRAL_TRIO_2 119..242 CDD:463965
RhoGAP-p50rhoGAP 278..473 CDD:239869 72/211 (34%)
spv-1NP_495666.4 FCH 195..278 CDD:214492
DR0291 281..>412 CDD:441187
C1 537..585 CDD:412127
RhoGAP 610..796 CDD:214618 64/189 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.