DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg12 and ATG12

DIOPT Version :9

Sequence 1:NP_648551.3 Gene:Atg12 / 39383 FlyBaseID:FBgn0036255 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_004698.3 Gene:ATG12 / 9140 HGNCID:588 Length:140 Species:Homo sapiens


Alignment Length:110 Identity:61/110 - (55%)
Similarity:79/110 - (71%) Gaps:2/110 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TPE--SQAALSTSSSTPADKDGSKICILLNATGNVPIIKKRTWTVDPNKTVGWIQTFIHKFLKLD 66
            |||  |.||:|..:..||.....||.|||.|.|:.||:|.:.|.|:..:|:..:..||.|||||.
Human    31 TPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLV 95

  Fly    67 ASEQIFLYVNQTFAPAPDQIIKNLYECHGTNGKLVLYYCKNQAWG 111
            ||||:|:||||:|||:|||.:..||||.|::|||||:|||:||||
Human    96 ASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg12NP_648551.3 APG12 25..111 CDD:252381 50/85 (59%)
ATG12NP_004698.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 9/18 (50%)
APG12 54..140 CDD:252381 50/85 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147242
Domainoid 1 1.000 114 1.000 Domainoid score I6108
eggNOG 1 0.900 - - E1_KOG3439
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37953
Inparanoid 1 1.050 125 1.000 Inparanoid score I4720
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1525971at2759
OrthoFinder 1 1.000 - - FOG0004016
OrthoInspector 1 1.000 - - oto91031
orthoMCL 1 0.900 - - OOG6_103577
Panther 1 1.100 - - LDO PTHR13385
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R104
SonicParanoid 1 1.000 - - X5029
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.