DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg12 and ATG12

DIOPT Version :9

Sequence 1:NP_648551.3 Gene:Atg12 / 39383 FlyBaseID:FBgn0036255 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_009776.1 Gene:ATG12 / 852518 SGDID:S000000421 Length:186 Species:Saccharomyces cerevisiae


Alignment Length:109 Identity:31/109 - (28%)
Similarity:57/109 - (52%) Gaps:3/109 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ETPESQAALSTSSSTPADKDGSKICILLNATGNVPIIKKRTWTVDPNKTVGWIQTFIHKFLKLDA 67
            ||.::.|..|...|...:|:..||.|.....|::..:|.....:..:::...:..|:.:.||:| 
Yeast    81 ETIKTNAQTSKQKSHKDEKNIQKIQIKFQPIGSIGQLKPSVCKISMSQSFAMVILFLKRRLKMD- 144

  Fly    68 SEQIFLYVNQTFAPAPDQIIKNLYECHGTNGKLVLYYCKNQAWG 111
              .::.|:|.:|||:|.|.|..|:....||.:|::.||.:.|:|
Yeast   145 --HVYCYINNSFAPSPQQNIGELWMQFKTNDELIVSYCASVAFG 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg12NP_648551.3 APG12 25..111 CDD:252381 24/85 (28%)
ATG12NP_009776.1 APG12 103..186 CDD:397985 24/85 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343837
Domainoid 1 1.000 49 1.000 Domainoid score I2961
eggNOG 1 0.900 - - E1_KOG3439
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I1805
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004016
OrthoInspector 1 1.000 - - oto100056
orthoMCL 1 0.900 - - OOG6_103577
Panther 1 1.100 - - LDO PTHR13385
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R104
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.780

Return to query results.
Submit another query.