DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg12 and ATG12A

DIOPT Version :9

Sequence 1:NP_648551.3 Gene:Atg12 / 39383 FlyBaseID:FBgn0036255 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001320241.1 Gene:ATG12A / 841861 AraportID:AT1G54210 Length:96 Species:Arabidopsis thaliana


Alignment Length:105 Identity:34/105 - (32%)
Similarity:59/105 - (56%) Gaps:13/105 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSTSSSTPADKDGSKICILLNATGNVPIIKKRTWTVDPN----KTVGWIQTFIHKFLKLDASEQI 71
            ::|.||:|:..  .|:.:.|.|||..||:|:..:.:...    |.:.:::..:|       |:.:
plant     1 MATESSSPSSV--RKVVVHLRATGGAPILKQSKFKIPGTDKFAKVIDFLRRQLH-------SDSL 56

  Fly    72 FLYVNQTFAPAPDQIIKNLYECHGTNGKLVLYYCKNQAWG 111
            |:|||..|:|.||:.:.:||...|.:||||:.|..:.|||
plant    57 FVYVNSAFSPNPDESVIDLYNNFGFDGKLVVNYACSMAWG 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg12NP_648551.3 APG12 25..111 CDD:252381 28/89 (31%)
ATG12ANP_001320241.1 Ubl_ATG12 13..95 CDD:340454 27/88 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I3757
eggNOG 1 0.900 - - E1_KOG3439
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I2518
OMA 1 1.010 - - QHG55762
OrthoDB 1 1.010 - - D1525971at2759
OrthoFinder 1 1.000 - - FOG0004016
OrthoInspector 1 1.000 - - otm3358
orthoMCL 1 0.900 - - OOG6_103577
Panther 1 1.100 - - LDO PTHR13385
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.