DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg12 and atg12

DIOPT Version :9

Sequence 1:NP_648551.3 Gene:Atg12 / 39383 FlyBaseID:FBgn0036255 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001233129.1 Gene:atg12 / 570965 ZFINID:ZDB-GENE-071205-7 Length:120 Species:Danio rerio


Alignment Length:112 Identity:54/112 - (48%)
Similarity:79/112 - (70%) Gaps:4/112 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ETPESQAALS---TSSSTPADKDGSKICILLNATGNVPIIKKRTWTVDPNKTVGWIQTFIHKFLK 64
            |.|:.:.:|.   |..|..:| :..||.:||.|.|..||:|.:.|:|:..:|:..:..||.:|||
Zfish    10 ENPKDEHSLQHAVTDHSESSD-EKKKIDVLLKAVGVTPIMKTKKWSVERRRTIQSLAQFISRFLK 73

  Fly    65 LDASEQIFLYVNQTFAPAPDQIIKNLYECHGTNGKLVLYYCKNQAWG 111
            |:.|||:|:||||:|||:|||.:..|:||.|::|||||:|||:||||
Zfish    74 LEPSEQLFIYVNQSFAPSPDQEVGVLFECFGSDGKLVLHYCKSQAWG 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg12NP_648551.3 APG12 25..111 CDD:252381 46/85 (54%)
atg12NP_001233129.1 APG12 34..120 CDD:252381 46/85 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580754
Domainoid 1 1.000 111 1.000 Domainoid score I6205
eggNOG 1 0.900 - - E1_KOG3439
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37953
Inparanoid 1 1.050 113 1.000 Inparanoid score I4832
OMA 1 1.010 - - QHG55762
OrthoDB 1 1.010 - - D1525971at2759
OrthoFinder 1 1.000 - - FOG0004016
OrthoInspector 1 1.000 - - oto39778
orthoMCL 1 0.900 - - OOG6_103577
Panther 1 1.100 - - LDO PTHR13385
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R104
SonicParanoid 1 1.000 - - X5029
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.