DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg12 and Atg12

DIOPT Version :9

Sequence 1:NP_648551.3 Gene:Atg12 / 39383 FlyBaseID:FBgn0036255 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001033584.1 Gene:Atg12 / 361321 RGDID:1306306 Length:141 Species:Rattus norvegicus


Alignment Length:107 Identity:57/107 - (53%)
Similarity:75/107 - (70%) Gaps:0/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PESQAALSTSSSTPADKDGSKICILLNATGNVPIIKKRTWTVDPNKTVGWIQTFIHKFLKLDASE 69
            |.|..|:|..:..|......||.|||.|.|:.||:|.:.|.|:..:||..:..||.|||:|.|||
  Rat    35 PPSSVAVSPGTEEPPGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTVQALIDFIRKFLRLLASE 99

  Fly    70 QIFLYVNQTFAPAPDQIIKNLYECHGTNGKLVLYYCKNQAWG 111
            |:|:||||:|||:|||.:..||||.|::|||||:|||:||||
  Rat   100 QLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg12NP_648551.3 APG12 25..111 CDD:252381 50/85 (59%)
Atg12NP_001033584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..54 5/18 (28%)
Ubl_ATG12 55..140 CDD:340454 49/84 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340891
Domainoid 1 1.000 113 1.000 Domainoid score I6034
eggNOG 1 0.900 - - E1_KOG3439
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37953
Inparanoid 1 1.050 120 1.000 Inparanoid score I4677
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1525971at2759
OrthoFinder 1 1.000 - - FOG0004016
OrthoInspector 1 1.000 - - oto98126
orthoMCL 1 0.900 - - OOG6_103577
Panther 1 1.100 - - LDO PTHR13385
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5029
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.760

Return to query results.
Submit another query.