DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg12 and lgg-3

DIOPT Version :9

Sequence 1:NP_648551.3 Gene:Atg12 / 39383 FlyBaseID:FBgn0036255 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_498228.1 Gene:lgg-3 / 175793 WormBaseID:WBGene00002982 Length:118 Species:Caenorhabditis elegans


Alignment Length:114 Identity:32/114 - (28%)
Similarity:56/114 - (49%) Gaps:5/114 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AETPESQAALSTSSSTPADKDGSKICILLNATGNVPIIKKRTWTVDPNKTVGWIQTFIHKFLKLD 66
            |.||......:.::|....| ..|:.:.|....:.|::|.:...|:|..||......:.|.|.:.
 Worm     6 ATTPTGNTEPTAAASAEPPK-SDKVTVRLRNIADAPVLKNKKMVVNPTDTVASFILKLRKLLNIQ 69

  Fly    67 ASEQIFLYVNQTFAPAPDQIIKNLYECHG---TNGKLV-LYYCKNQAWG 111
            |:..:|||::.||||:||...:.|..|:.   |:.::: |.|....|:|
 Worm    70 ANNSLFLYIDNTFAPSPDTTFETLSRCYSVKITDKEILELQYSITPAYG 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg12NP_648551.3 APG12 25..111 CDD:252381 26/89 (29%)
lgg-3NP_498228.1 Ubiquitin_like_fold 28..118 CDD:391949 26/89 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159379
Domainoid 1 1.000 53 1.000 Domainoid score I7647
eggNOG 1 0.900 - - E1_KOG3439
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I4059
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55762
OrthoDB 1 1.010 - - D1525971at2759
OrthoFinder 1 1.000 - - FOG0004016
OrthoInspector 1 1.000 - - oto18887
orthoMCL 1 0.900 - - OOG6_103577
Panther 1 1.100 - - LDO PTHR13385
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R104
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.