DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg12 and atg12

DIOPT Version :9

Sequence 1:NP_648551.3 Gene:Atg12 / 39383 FlyBaseID:FBgn0036255 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_002940007.1 Gene:atg12 / 100493403 XenbaseID:XB-GENE-5730378 Length:133 Species:Xenopus tropicalis


Alignment Length:109 Identity:57/109 - (52%)
Similarity:80/109 - (73%) Gaps:2/109 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PESQAA--LSTSSSTPADKDGSKICILLNATGNVPIIKKRTWTVDPNKTVGWIQTFIHKFLKLDA 67
            |::..|  :|.|:..|..:...||.:||.|.|:.||:|.:.||::..::|..:..||.|||||||
 Frog    25 PDTAPAPVVSPSAEEPHSETKRKIDVLLKAVGDTPIMKTKKWTIERTRSVQGLMDFIKKFLKLDA 89

  Fly    68 SEQIFLYVNQTFAPAPDQIIKNLYECHGTNGKLVLYYCKNQAWG 111
            :||||:||||:|||:|||.:..||||.|::|||||:|||:||||
 Frog    90 AEQIFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg12NP_648551.3 APG12 25..111 CDD:252381 50/85 (59%)
atg12XP_002940007.1 Ubl_ATG12 47..132 CDD:340454 49/84 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 119 1.000 Domainoid score I5756
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37953
Inparanoid 1 1.050 123 1.000 Inparanoid score I4589
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1525971at2759
OrthoFinder 1 1.000 - - FOG0004016
OrthoInspector 1 1.000 - - oto104813
Panther 1 1.100 - - LDO PTHR13385
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R104
SonicParanoid 1 1.000 - - X5029
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.