DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir68b and PPP1R9B

DIOPT Version :9

Sequence 1:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_115984.3 Gene:PPP1R9B / 84687 HGNCID:9298 Length:817 Species:Homo sapiens


Alignment Length:100 Identity:20/100 - (20%)
Similarity:44/100 - (44%) Gaps:22/100 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LPGIYALAEIACRIAVEQNVQVTYLYRCASCPASFDADYSALELDLYRCVGSRLPVITRNMEAHE 77
            |.|.:..|:..|: ||:::::.|            .|.|.|||...     |:...:.::.:..|
Human   723 LEGYWGEAQSLCQ-AVDEHLRET------------QAQYQALERKY-----SKAKRLIKDYQQKE 769

  Fly    78 LEPFRRTDS----LSIFQIPAAEKGDSLVRRILDM 108
            :|..::..:    |...::...|:.|.|:.:|.::
Human   770 IEFLKKETAQRRVLEESELARKEEMDKLLDKISEL 804

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489
PPP1R9BNP_115984.3 PDZ_5 426..489 CDD:375353
PP1-binding motif. /evidence=ECO:0000250|UniProtKB:O35274 447..451
Interaction with RGS2. /evidence=ECO:0000250 480..525
PDZ 493..582 CDD:214570
Interaction with TGN38. /evidence=ECO:0000250 595..816 20/99 (20%)
SMC_prok_B <649..>812 CDD:274008 20/99 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..165
Actin-binding. /evidence=ECO:0000250 1..154
Interaction with D(2) dopamine receptor. /evidence=ECO:0000250 100..371
Actin-binding. /evidence=ECO:0000250 164..283
Interaction with ADRA2A, ADRA2B and ADRA2C. /evidence=ECO:0000250 169..255
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..447
Interaction with protein phosphatase 1. /evidence=ECO:0000250 417..494
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1945
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.