DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir68b and ppp1r9ala

DIOPT Version :9

Sequence 1:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster
Sequence 2:XP_700731.6 Gene:ppp1r9ala / 571989 ZFINID:ZDB-GENE-091204-412 Length:1332 Species:Danio rerio


Alignment Length:95 Identity:25/95 - (26%)
Similarity:37/95 - (38%) Gaps:25/95 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   473 RDRRAAFIMRDFHARDFLAI--TYD---SQAERPAYHIAREYLRSMICTYILPRGSPFLHRLESL 532
            |..|:|...|:.:..||.||  ::|   |.:|      |:.|...........||.||.:|:..:
Zfish    10 RTLRSASPHRNAYKSDFHAIKCSFDGTKSDSE------AKSYANGASDPREDSRGRPFGNRVNKI 68

  Fly   533 YSGFLEHGFFEHWRQMDLITRVGASPDAEE 562
            .:.||         |||     |..|...:
Zfish    69 KNIFL---------QMD-----GQQPQESQ 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 25/95 (26%)
ppp1r9alaXP_700731.6 PDZ 593..680 CDD:214570
Tankyrase_bdg_C 932..>1009 CDD:291973
SAM_Neurabin-like 1234..1293 CDD:188911
SAM 1237..>1284 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1945
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.