DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir68b and ppp1r9a

DIOPT Version :9

Sequence 1:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster
Sequence 2:XP_009292641.1 Gene:ppp1r9a / 560862 ZFINID:ZDB-GENE-060503-660 Length:1076 Species:Danio rerio


Alignment Length:95 Identity:19/95 - (20%)
Similarity:39/95 - (41%) Gaps:22/95 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 VRPSYEEQVDRVDDLVHLDVHIYAVTTMYDAVRSALTEHQYGLLENRSRQLPLGIATSYYQPVVR 471
            ::.|.|:..:|   ::.|:.:.....|:...|...|.|                 |.|.|| .:.
Zfish   676 LKQSIEDNKER---MLKLESYWIEAQTLCHTVNEHLKE-----------------AQSQYQ-ALE 719

  Fly   472 RRDRRAAFIMRDFHARDF-LAITYDSQAER 500
            ::..:|..:::||..|:. .|...|::.:|
Zfish   720 KKYNKAKKLIKDFQQREMEFAQREDTEKKR 749

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 19/95 (20%)
ppp1r9aXP_009292641.1 PDZ_signaling 464..547 CDD:238492
DUF342 <701..786 CDD:302792 14/67 (21%)
SAM_Neurabin-like 973..1030 CDD:188911
SAM 976..>1029 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1945
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.