DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir68b and ppp1r9ba

DIOPT Version :9

Sequence 1:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster
Sequence 2:XP_021329200.1 Gene:ppp1r9ba / 558232 ZFINID:ZDB-GENE-091006-1 Length:803 Species:Danio rerio


Alignment Length:68 Identity:16/68 - (23%)
Similarity:21/68 - (30%) Gaps:27/68 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 LVHLDVHIYAVTTMYDAVRSALTEHQYGLLENRSRQLPLGIATSYYQPVVRRRDRRAAFIMRDFH 485
            ||..|||                    ..|||       |.|||.:.|..::.:...|....:.|
Zfish   338 LVQADVH--------------------ASLEN-------GEATSSHDPSEQKEETEEACAEEESH 375

  Fly   486 ARD 488
            ..|
Zfish   376 RED 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 16/68 (24%)
ppp1r9baXP_021329200.1 Herpes_pp85 185..>333 CDD:332820
Herpes_ICP4_C 227..>459 CDD:332854 16/68 (24%)
PDZ_signaling 486..569 CDD:238492
SMC_N <635..>799 CDD:330553
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1945
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.