powered by:
Protein Alignment Ir68b and ppp1r9ba
DIOPT Version :9
Sequence 1: | NP_648548.1 |
Gene: | Ir68b / 39378 |
FlyBaseID: | FBgn0036250 |
Length: | 635 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021329200.1 |
Gene: | ppp1r9ba / 558232 |
ZFINID: | ZDB-GENE-091006-1 |
Length: | 803 |
Species: | Danio rerio |
Alignment Length: | 68 |
Identity: | 16/68 - (23%) |
Similarity: | 21/68 - (30%) |
Gaps: | 27/68 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 421 LVHLDVHIYAVTTMYDAVRSALTEHQYGLLENRSRQLPLGIATSYYQPVVRRRDRRAAFIMRDFH 485
||..||| ..||| |.|||.:.|..::.:...|....:.|
Zfish 338 LVQADVH--------------------ASLEN-------GEATSSHDPSEQKEETEEACAEEESH 375
Fly 486 ARD 488
..|
Zfish 376 RED 378
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1945 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.