DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir68b and grik4

DIOPT Version :9

Sequence 1:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster
Sequence 2:XP_021322087.1 Gene:grik4 / 556582 ZFINID:ZDB-GENE-070821-5 Length:965 Species:Danio rerio


Alignment Length:361 Identity:68/361 - (18%)
Similarity:116/361 - (32%) Gaps:126/361 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 YGRCLPNGNYTGVVSDIVGGHTHFA-------PNSRFVLDCIWP----AVEVLYPYTRRNLHLVV 298
            ||....||.:||:|.:::......|       .....|:|...|    .:.::|     .:|:  
Zfish   473 YGVPGANGTWTGMVGELISRKADLAVAALTITAEREKVIDFSKPFMTLGISIMY-----RVHI-- 530

  Fly   299 PASAIQPEYLIFVRVFRRTVWYLLLVTLLVVVLVFWVMQRLQRRIPRRGVIQFQATWYEILEMFG 363
               ..:|.|..|:..|...||..:|:..|.|..|.:::.||.           ...||.      
Zfish   531 ---GRRPGYFSFLDPFSPGVWLFMLLAYLAVSCVLFLVARLT-----------PYEWYN------ 575

  Fly   364 KTHVGEPA--GRLS------SFSSMRTFLMG----------------------WILFSYVLSTIY 398
                ..|.  ||.|      |..:...|.:|                      |..|:.::.:.|
Zfish   576 ----PHPCLKGRCSLLINQYSLGNSFWFPVGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSY 636

  Fly   399 FAKLESGFVRPSYEEQVDRVDDLVHLDVHIYAVTTMYDAVRSALTEHQYGLLENRSRQLPLGIAT 463
            .|.|.:.......|..::.||||               |.::|:   :||.:..       |...
Zfish   637 TANLAAFLTVQRMEVPIESVDDL---------------ADQTAI---EYGTMHG-------GSTM 676

  Fly   464 SYYQPVVRRRDRRAAFIMRDFHARDFLAITYDSQAERPAYHIAREYLRSMICTYILPRGSPFLHR 528
            :::|....:..:|....|.......|:..|.:.        |||.                    
Zfish   677 TFFQNSRYQTYQRMWNFMYSKQPSVFVKSTEEG--------IARV-------------------- 713

  Fly   529 LESLYSGFLEHGFFEHWRQMDL-ITRVGASPDAEEF 563
            |.|.|:..||....|::||.:. :|::|...|.:.:
Zfish   714 LNSNYAYLLESTMNEYYRQRNCNLTQIGGLLDTKGY 749

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 45/262 (17%)
grik4XP_021322087.1 Periplasmic_Binding_Protein_Type_1 26..400 CDD:324556
PBP2_iGluR_kainate_KA1 425..785 CDD:270442 68/361 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590985
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.